KEGG   Tetrapisispora phaffii: TPHA_0A04800Help
Entry
TPHA_0A04800      CDS       T02235                                 

Gene name
TPHA0A04800
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tpf  Tetrapisispora phaffii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:tpf00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1088022..1090304
Genome map
AA seq 760 aa AA seqDB search
MESTTSGFDEHQNLSDLSKRNNKDNVQEDVVDQIDDNKTQINEKKNVCAKNHLGFGNILV
KIEPILGPLLITILSFVVRFYKIDRNKNVVWDEAHFGKFGSYYIKHEFYHDVHPPLGKML
IALSEWLAGFDGDFDFESNTAYPAGVDFKFMRQFNATFGALCAPVTYYTAKWMGFNILTV
YLVSIMVTLELSYIALSKFILLDSMLLFFTMTTFSCMVKIYNLRNKPFTPQWSIWMLLTG
INIGCVCSVKWVGLFITVIVGLYTIVELWALSCDATLSRKKYYKHWLIRIIDLIIIPFLV
YMNCFKVHFSLLYKSGTGDASTNTLFQVNLEGTQIENSPRTVMFGSDVTIRSHGLSPNLL
HSHIQTYPVGSLQNQITGYGFSDENNKWTFKFAREDGIFFDSNNKTVNGELIAVKDGDTV
RLNHKSTMRNLHSHYVASHVSQGNFEVSGYGTDEGGDAKDNWIIEIVQQLKSNNPDFHQE
DSENIHPVSTFFRLRHQELGCYLASTGFSYPGWGFKQSEIVCKNSWSKRDKSTWWNVEDH
WNDMLEIEDDYVPPKSKFWTDFILINFAMAASNNALIPDDDKYDNLASEPWEWPTLHIGL
RMCTWAHDVYRYYLIGSPFNTWLSTASLFVCIIILAYTLYEWRRQKIHLNENNIWKLSIQ
FVFPFIAWVTHFVPFLIMGRVTYVHHYLPALYFSMLVFASTVDYLLSGSKTYIKYPSYLI
LFGSCIYIYIIFAPLCQGMTGFNNEDLKKISWLSSWDFNF
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggagtctacaacttcaggttttgatgaacatcagaatctttcagacctgtcgaaaaga
aataataaagataatgttcaagaggatgtggtagatcaaattgacgataacaaaacccaa
ataaatgagaaaaagaacgtttgtgctaaaaatcaccttggatttggcaatatactggta
aaaatcgaaccaattcttggtcctcttcttattacaatattatcctttgtagtaagattt
tataaaattgatagaaacaagaatgtcgtttgggatgaagctcattttggtaaatttggc
tcatattatatcaaacatgaattttatcatgatgtacatccacctttaggtaaaatgtta
atcgcattaagtgaatggctagcaggatttgatggtgattttgattttgaatcaaataca
gcttatcctgctggcgtagattttaagtttatgagacaattcaatgcaacatttggtgca
ttatgtgcaccagtcacttattacactgccaaatggatgggttttaatattttaactgtt
tatttggtatccattatggtgactttagaactgtcatatattgcgttatcaaagtttatt
ttattagattcaatgttactattttttactatgacaactttttcttgtatggttaaaatt
tataatttgagaaacaaaccattcacaccacaatggtccatatggatgcttttaactggt
attaacattggatgcgtatgctcagtgaaatgggtaggtttatttataactgttattgtt
gggttatacacaatcgtggaactatgggctctctcatgtgatgctacgttatcaagaaag
aaatattacaaacattggttgatcagaataattgatttaataataataccatttttagtt
tatatgaattgtttcaaagttcatttctcattactgtataagtcaggaacgggtgatgca
tcaacaaatacattatttcaagtcaatctcgaagggacacagattgaaaacagtccaaga
acagttatgtttggctccgatgtcacaattcgttctcatggtttaagcccaaacctgtta
cattctcacattcaaacttatccggtaggatcattacagaatcaaattactggttatggg
ttttctgacgaaaataataaatggacttttaaatttgctagagaagatggtatattcttt
gattctaacaataaaactgtaaatggagaactaatagctgtaaaggatggtgacactgtc
agattaaatcataaaagtactatgagaaatttacactcgcactatgtggcttctcatgta
tcacaaggtaattttgaagtctctggttatggaactgacgaggggggtgatgcaaaagac
aattggatcatcgagatcgttcaacaattaaaatcaaacaatcctgactttcatcaagaa
gattcagaaaatatacatccagtttccactttttttagactgagacatcaagaattaggt
tgttatttagcctctacaggattttcgtatccaggttggggttttaagcaatccgaaatt
gtttgcaagaactcttggtctaagcgtgacaaatcgacatggtggaatgtggaagatcat
tggaatgatatgctggaaattgaagatgactatgttccaccaaaatctaaattttggact
gattttattctaattaattttgctatggctgcatcaaacaatgctctaattcccgatgat
gataaatacgataatttggcatcagaaccttgggaatggccaacattacatattgggtta
cgtatgtgcacttgggctcatgatgtatacagatactatttaattggatctccattcaat
acatggctttcaacagcttcactttttgtttgcataataattttggcatatacattatat
gaatggagaagacaaaagattcatctaaatgaaaacaacatatggaagctatccatacaa
tttgttttcccttttattgcatgggtcactcattttgtgccatttctgataatgggaaga
gttacatatgttcatcattatttacctgcactttatttttctatgttagtgtttgcatcc
acagtcgactatttgttgagcggtagtaaaacatacatcaaatatccatcttatctaata
ttatttggtagttgtatctacatttacatcatatttgctccactttgtcaaggtatgact
ggatttaataatgaagacttgaaaaagatctcatggttatcatcttgggatttcaatttc
taa

DBGET integrated database retrieval system