KEGG   Tetrapisispora phaffii: TPHA_0A05200Help
Entry
TPHA_0A05200      CDS       T02235                                 

Gene name
TPHA0A05200
Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0A05200 (TPHA0A05200)
   01230 Biosynthesis of amino acids
    TPHA_0A05200 (TPHA0A05200)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPHA_0A05200 (TPHA0A05200)
   00030 Pentose phosphate pathway
    TPHA_0A05200 (TPHA0A05200)
   00051 Fructose and mannose metabolism
    TPHA_0A05200 (TPHA0A05200)
   00052 Galactose metabolism
    TPHA_0A05200 (TPHA0A05200)
  Energy metabolism
   00680 Methane metabolism
    TPHA_0A05200 (TPHA0A05200)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TPHA_0A05200 (TPHA0A05200)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TPHA_0A05200 (TPHA0A05200)
Protein phosphatases and associated proteins [BR:tpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TPHA_0A05200 (TPHA0A05200)
Messenger RNA biogenesis [BR:tpf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TPHA_0A05200 (TPHA0A05200)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1168851..1171826)
Genome map
AA seq 991 aa AA seqDB search
MSSLNNCYGVAFRSIATADETLFHSTIKFYHSLGFSTIKEFDKFKHGQNALLSSGTSEGS
IKENWLEAFKLSEVDQAGFRIPQQEASNKKQSQGALLKIRLIMKHEAKAHPIFVEDNSTT
VTYFSIDLKQILAKFPDATRISDTLISVNDPLNNKIFFTSFANALDSEPTMKDFFMTGLS
EEEKQSQIAKDAAEFLQKSLINKSKNGSIKKKIAVMTSGGDSPGMNAAVRAVVRTGIHYG
CDVYAVYEGYEGLLRGGEYLKKMAWEDVRGWLSEGGTLIGTARSMDFKQRWGRKQAAGNL
ISEGIDALIVCGGDGSLTGADLFRHEWPSLVEELVADGKFTQAQVDPFKHLTIVGLVGSI
DNDMSGTDSTIGAYSSLERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGA
DYIFIPERASVKGKWEDELKEVCSRHKSKGRRNITVIVAEGALDNELNAISADDVKDVLV
DLGLDTRVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLEATPETPSPLIGINENKIIR
MPLVESVKLTGSVATAIEARDFDKAISLRDPEFIELYENFLSTTIKDDGSELLPEDKRLK
IAIVHVGAPSAALNAATRAATLYCISHGHKPVAITNGFSGLIQTGEVKELSWLDVEDWHN
LGGSEIGTNRSVASEDMGTIAYYFQKNKFDGLIILGGFEGFKSLKQLRNSRSEYPIFNIP
MVLIPSTVSNNVPGTEYSLGVDTCLNSLVKYTDEIKLSASATRRRVFVVEVQGGHSGYIA
SFTGLVTGAVSVYTPEEKINLDSIQEDIALLKENFLKDQGENRNGKIIIRNEEASCVYTT
DMLGDIFAENSGKAFGVRTAIPGNYQQGGSPSSKDRVIASRFAVRCVKFIEQWNDKNQSV
GENIDSKVLRFKFNDCGEKVPTIEHEDDSAAVICVNGSSVSFKPVASLWDTETNVALRKG
HEIHWTNFNEISDILSGRLRLRAELEASKSQ
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctctaaataattgttatggagtagctttcagatcaatagctactgctgatgaa
actttatttcacagcaccattaagttctaccacagtttaggtttctcaaccatcaaagaa
ttcgataaattcaaacacggtcaaaatgctctattatcttcgggtacttcagaaggttca
attaaagagaattggttggaagcttttaaattaagcgaagtcgatcaagcaggttttaga
atcccacaacaagaagcttccaacaagaagcaatctcaaggtgctctattgaaaatccgt
ttaatcatgaaacatgaggctaaggctcatccaatttttgttgaagataactctacaaca
gtcacttatttctccatagacttgaagcaaattttagctaagttccctgatgccactaga
atttcagacactttgatatctgtgaatgatcctttaaacaacaaaatattcttcacttct
tttgctaatgctttggactctgaaccaactatgaaagattttttcatgactggtttatcc
gaggaagaaaaacaatctcaaattgctaaagatgctgctgaatttttacagaaatctctt
atcaacaagagcaaaaatggttcaattaagaagaagattgccgttatgacttccggtggt
gattctccaggtatgaatgctgctgtcagagctgtcgtcagaactggtatccattatggt
tgcgatgtttatgctgtttacgaaggttacgaaggtttactaagaggtggtgaataccta
aagaaaatggcttgggaagatgtcagaggttggttgagtgaaggtggtactctaatcggt
actgctagatccatggatttcaaacaaagatggggtagaaagcaagctgctggtaattta
atctctgaaggtatcgatgccttaattgtctgtggtggtgatggttctttaaccggggct
gatttattcagacacgaatggccatctttagtcgaagaattggtcgctgatggcaaattc
acccaagctcaagtcgacccattcaagcacttgaccattgtcggtttagttggttccatt
gataacgatatgtctggtaccgattctaccattggtgcttactcttctttggagagaatc
tgtgaaatggttgattacatcgatgctactgccaaatctcattccagagctttcgttgtc
gaagttatgggtagacattgtggttggttagctttaatggctggtattgccacaggtgct
gactacatttttattccagaaagagcctctgtaaagggcaaatgggaagatgaattaaag
gaagtttgttccagacacaaatctaagggtagaagaaacatcaccgtcattgtcgccgaa
ggtgctttagataacgaattaaacgcgatttctgctgatgatgttaaagatgtcttagtt
gacttaggtttggataccagagttaccatcttaggtcacgttcaaagaggtggtaccgct
gttgctcatgacagatggttagctactttacaaggtgttgacgctgtgaaggctgtctta
gaagctactccagaaaccccatctccattaatcggtattaacgaaaacaagattatcaga
atgccattagttgaatcggtcaaattaactggttccgtagctactgctatcgaagccaga
gacttcgacaaggctatctccctaagagacccagaattcattgaattatatgaaaatttc
ttatctaccaccattaaagatgatggttctgaattactacctgaagacaagagattaaag
attgctattgtccatgtcggtgctccatctgctgccttaaatgccgctaccagagccgcc
actttatactgtatatcacatggtcacaaaccagttgccattaccaatggtttcagtggt
ttaatccaaactggtgaagttaaagaattgtcatggttagatgtcgaagactggcacaac
ttgggtggttcagaaattggtactaacagatccgtcgcttctgaagacatgggtaccatt
gcatactacttccaaaagaacaaatttgatggtttaatcatcttaggtggtttcgaaggt
ttcaaatctttaaaacaattacgtaactctagatctgaataccctatctttaacatccca
atggtgttaatcccatccactgtttctaacaacgttccaggtaccgaatactctttaggt
gtcgacacgtgtttgaattctttggttaaatacactgatgaaattaaattatctgcttca
gccaccagaagaagagttttcgtcgttgaagttcaaggtggtcactccggttatattgct
tctttcactggtttagttaccggtgctgtctctgtctacaccccagaagaaaaaattaac
ttggattctattcaagaagatattgctttattgaaggaaaacttcttaaaggatcaaggt
gaaaaccgtaacggtaagattataatcagaaatgaagaagcttcttgcgtatacaccact
gatatgttaggtgacatctttgctgaaaactcaggtaaagcatttggtgttagaactgct
attccaggtaactaccaacaaggtggttctccatcttccaaagatcgtgtcattgcttcc
agatttgctgttagatgtgttaaattcattgaacaatggaatgacaagaaccaatctgtt
ggtgaaaatattgactccaaggttctaagattcaaattcaatgactgtggtgaaaaagta
ccaaccattgaacacgaagatgattcagctgctgtcatttgtgtgaacggttcatctgtt
tcattcaaaccagttgcttcgttgtgggatactgaaaccaatgttgcattaagaaagggt
catgaaatccactggactaatttcaatgaaattagtgacatcttatctggtaggttaaga
ttaagagccgaactagaagcttctaaatcccaataa

DBGET integrated database retrieval system