KEGG   Tetrapisispora phaffii: TPHA_0B00290Help
Entry
TPHA_0B00290      CDS       T02235                                 

Gene name
TPHA0B00290
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tpf  Tetrapisispora phaffii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TPHA_0B00290 (TPHA0B00290)
Enzymes [BR:tpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     TPHA_0B00290 (TPHA0B00290)
Glycosyltransferases [BR:tpf01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TPHA_0B00290 (TPHA0B00290)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:55686..57956
Genome map
AA seq 756 aa AA seqDB search
MAVVKRNKSKSVDVDESENKYSKGVEKVEFIGQRWLSQPLPDAEPTYNTWMYIVTTIAFI
TRFYKIWNPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMMIAFIGFLVGYDGSFKFE
EIGMPYDKNPAPYIAYRSFNALLGTLTVPIMFLTLKELNFKAITCAFAALLVAVDNAHVT
ETRLILLDAILIISIAASLCCYVRFYKEQLKAPFSTSWYIWLYATGLSLSFVISTKYVGV
MTYVAIGIPVIVNLWQLLDIRTGLTLHTFARHFLRRLNGLVFAPFIVYLFWFWCHFSILI
NSGPGDAFMSQDFQETLNESALAKEAKQINYFDIVTFKHKDTEAYLHSHLLNYPLRYEDG
RVSSNGQQVTGYVHEDKNNEWEILPVKELKSKIGQPVLQGEQIRLRHVSTDTYLLTHDVA
SPLYPTNEEVTTVSEEDANGERYQQTLFTLQPVNKKDNGRKIKSKMTSFRIFHVDTAVAL
WTHNDELLPDWGKSQQEVNGNKKVTSSENTWLVETIVNLDEARKIYYPKVIKTLPFISKW
LEAQRLMFEHNNKLSSEHPFASEPYTWPGSLNGVSFWTDDEKKLQIFFIGNIIGWWFQVI
SLAVFVGLVCADLITRQRGYYALNEITREKIYGPLLFFFIGWCCHYFPFFLMGRQKFLHH
YLPAHLIAALFSAALWEVIFSNTKTEDPSKDDKDAAYNTTAVVIHDKQLSLFFLIVSVAV
VGFFIYFAPLVYGDISLTPEQVQSRKWFNLKLHFAK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgtcaagagaaataaaagcaagtcggttgatgttgatgaatcggagaacaag
tattctaaaggggttgagaaggtagaattcattggccaacgttggttaagccaacctctt
ccggacgcagaaccaacttacaatacatggatgtatattgttactaccattgctttcatt
actagattttataagatttggaatcctaaggaagtggttttcgatgaagtccattttggt
aagtttgcttcctattatctggaaagaacctatttcttcgatgtccatccaccttttgct
aagatgatgattgctttcattgggtttttagttggttatgacggttcatttaagttcgaa
gaaattggaatgccttatgacaaaaacccagcaccatacattgcctaccgttcttttaac
gctttattaggtacattaactgttcctattatgttcctaacactaaaggaattaaatttc
aaagctattacttgtgcttttgctgctcttttagttgctgttgacaacgctcacgttacg
gaaacaagattgattttattagatgcaattttgattatttcaatcgcagcatcattatgc
tgttatgttcgtttctacaaagaacaactaaaggctcctttctctacctcgtggtacatt
tggttgtatgctactggtttatctttatcatttgtcatctctaccaaatatgttggtgtt
atgacatatgtcgctataggtatcccagtcattgtcaatctatggcaattgttagatatc
agaactggattgactttgcacacttttgctagacatttcttgaggagattaaatgggttg
gtatttgccccattcatcgtatacttattctggttctggtgtcacttctctattctgatc
aattctggtccaggtgatgcttttatgtcacaagatttccaagaaactttgaacgaatct
gcattagccaaagaagcaaagcaaattaattattttgacattgtcactttcaagcacaag
gacaccgaggcttacctacattctcatttattaaattatccattacgttacgaagatggt
cgtgtttcttcaaatggccaacaagttacaggatatgtccatgaagataagaacaatgaa
tgggaaattcttccagtcaaagaattaaaatcaaaaataggtcaacctgttttacaaggg
gagcaaattagattgagacatgtttctactgatacatacctattaacacacgacgtggcc
tctccattatacccaactaatgaagaagttacaactgtttcagaagaagatgccaatggt
gaacgctaccaacagacgttgttcactctgcaaccagtaaacaaaaaagataatggtcgt
aagataaaatccaaaatgacatctttccgtatcttccatgttgatactgctgttgctcta
tggacacacaatgacgaattgcttccagactggggtaaatctcaacaagaagttaatggt
aacaaaaaagttacttcttcagaaaatacttggttagttgaaactattgttaatttagat
gaagccaggaagatatattatccaaaagttattaaaacgttaccattcatctccaagtgg
ttagaagcccaaagattaatgtttgaacacaataacaaattatcctctgagcacccattt
gcttctgaaccatacacatggccaggtagtttgaatggtgtatccttctggactgatgac
gagaaaaaactacaaattttctttattggtaacattattggatggtggtttcaagtcatt
tctttggctgtgtttgttggcttagtttgtgctgatttaattaccagacaacgtggatac
tatgcattaaatgaaattacaagagaaaaaatatatggtccattattattcttcttcatc
ggatggtgttgtcattactttccattcttcttaatgggtcgtcaaaagtttttacatcac
tacttaccagctcatttaattgctgccctattctctgctgctctgtgggaagttattttt
agtaataccaaaactgaagacccaagtaaggatgataaagatgctgcttataatactact
gcggtagtcattcatgataagcaactttctctattcttcctcatcgtttcagttgctgtt
gtgggattttttatatattttgcaccattagtttatggtgatatttcattaacaccagag
caagttcaaagtagaaagtggtttaacttaaaattacatttcgctaaataa

DBGET integrated database retrieval system