KEGG   Tetrapisispora phaffii: TPHA_0B00540Help
Entry
TPHA_0B00540      CDS       T02235                                 

Gene name
TPHA0B00540
Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tpf00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(116377..121023)
Genome map
AA seq 1548 aa AA seqDB search
MIYKIWYILSFVLLRIPSWIFVTANAIKFTIPFTTLFVTFIITSYVIYYIVKSRVLSQYK
KLTPEKEELKSLGSSSSKCSSVNLDQARSSAQDKSSKHEKKNIFFHYEDDRSFSSYLDQF
LSAIKIFGYLEKPVFNDLTKNMKTQKLNEGEILLLDDAIGLAIVVEGSLQIYHNVSDNSG
NGIISNSYTKNCANDYINSASVNYSSEHSSISDNLKVENSCLDTNSNNSETSSNNDNYEE
SDGFSEDSNTYIRFKNGSGKYQLLNTVKPGNPVSSLVNILNLFTSKKSKQNSNNNAQENI
TNNNSTSNLSNSQNFSHFGAKDLSTLTFDDANPVFYPLPNIVARAATNCTIAIIPPKSFS
KLVETYPRSASHIIQMVLTRLYRVTFQTAHDYLGLTSEIMEIEYLLNKNVRYELPYFLKE
AVVNCYKHTKQAYSTNNNSKGSSIINLNSKTSNKSSSSTKSFLSEIPLKFSVPKSKSNSQ
LNTNNIFESFGGGSRNFVLKSSKDHSNPGDLLSNVPLTRRDLSTSDAVTPISSNNNFSAI
LDNALSPLLEFENEKRPVKIKNGFPEVSNNKSEKTQRGTLNSHSDSENDGKIKYFSLQEG
TDEATLRFALVEAIFNILSINEESFYAKKSRTASLTTPTLTHRISNSSDNSLESSIYSTQ
QDYPDSAIKILPSEYAITSHKFKPKLSTTYKEEVPTSIDFESVKKEFSDNIDLQYHPKGE
TIVEQNNNSKGLFYVISGSIDVTYTNSPGMDYVPEMNSSNKEFNEDLKKVEQFLYTVESG
GIAGYLASLVNSKSFVNLKARTDVYVGFLSNQTLERFYDKYCLLHLRLAEILTTLISPRM
LKLDHALEWIHLSASETLFNKGDPANGIYVILNGRVRQVSDKHYFQSPELAQGESFGEVE
VLTAMNRMSSIQAVRETELARIPRTLFGILALEQPSIMFRISRLVARKILDINLGSDVPT
RVTADNGYKYDFNLMIPSLNGNAHKGAHPKNKNSYRTITILPVTEGLPVNSFANKLVQAF
RQVGRNTIGLNMRTALNHLGRHAFDKLAKLKLSGYFAELEVMYQTVVYIADSPVNSSWTN
TCISQGDCILLLADANDSADIGEYELLLQKVGTTARTELILLHPERYVEPGSTYNWLKQR
NWVDAHHHMQFLVNPLSERLNMRSHNKNASRLALVDRIMNTEFSKLTQENISKYVPESIK
SKVETISRRIRGRSHQYYSSSDPNKNDFLRLARILSDQAIGVVLGGGGARGISHLGVLQA
IEEQGIPIDLIGGTSMGAFVAGLYAKDYDIVPIYGRLKSFCARIGSLWRMIGDLTWPVTS
YTTGHEFNRGIWKTFGDTRIEDFWIQYYCNSTNITESIQEIHSFGYAWRYIRASMSLAGL
LPPLEAKGSMLLDGGYVDNLPVDEMKGRGCDIVIAVDVGSVDDRTPMNYGDSLNGFWILF
NKWNPFSSYPNIPTMAEIQMRLGYVSSVNALERAKRTPGIIYTRPPVADFATLDFGKFEQ
IYNVGLDYGRSYLKTLIENKNMPFIAGSKATLIDTAIPEFLSRRRNSI
NT seq 4647 nt NT seq  +upstreamnt  +downstreamnt
atgatctacaaaatttggtacatcttatcatttgttttattaagaatacctagttggata
tttgttactgcaaatgccatcaagtttacaattccatttacaacactctttgtcacattt
ataatcacaagttatgttatttattatattgtgaaaagtagggtattatctcaatataaa
aagctaaccccagaaaaagaagagttaaaaagtttgggttcttcttcatctaaatgttct
tcagttaatctagatcaagcaagaagttctgctcaagataagagttcaaaacatgaaaag
aaaaacatcttttttcattacgaagatgatagatctttttcttcttatctggatcaattt
ttgagtgctattaagatttttggatacttagagaaacctgtattcaatgatttgactaag
aatatgaagactcaaaagctaaatgaaggtgagatccttttattagatgatgcaataggt
ttggccatcgtcgttgaaggtagcttacaaatataccacaacgtgtcagataattctggt
aatggtatcatatcaaattcctatactaaaaattgtgctaatgactacattaattctgca
tcagttaattacagttctgaacattcaagtattagtgataatcttaaagttgaaaactcc
tgcttagatacaaattctaataacagcgaaacatcttctaacaatgacaattatgaagaa
tcagatggattttcagaagattcaaacacttatataaggtttaaaaatggttctggaaaa
tatcagttattaaataccgtaaaacctggtaaccctgtatcgtccttggtaaatatacta
aatttattcacctcaaagaaatcaaaacagaattcgaataataatgcacaagaaaacatt
acaaacaataattctactagtaacttgtcaaattctcaaaacttctctcatttcggtgca
aaggacttatcaaccttaactttcgatgatgcaaatcctgttttctatcctttgcctaat
atagtagccagagctgctacaaattgcacaattgctatcattccaccaaagtcttttagc
aaactggtagagacctaccctagatcagcttctcatatcatacaaatggtcttaacaaga
ctatatagagttacttttcaaacggctcatgattatttgggattaacttccgaaattatg
gagatagaatacttgttaaacaagaatgttagatacgaattaccatattttttgaaagaa
gctgttgttaattgttacaaacatactaaacaagcatattctaccaataataattcaaaa
ggtagtagtattattaatcttaattcaaagacttcgaataaatctagttcttctactaaa
tcatttttatcagaaattccactaaaattcagtgtacctaaatccaagtcaaactcccaa
ctaaatacaaacaatatatttgaaagttttggaggtggatccaggaattttgttttaaaa
tcttcgaaagatcacagtaatcctggagatttattatctaatgttcctttgacgagaaga
gatctttcgacctcagatgctgtaactcctatttcatcgaataataacttctcagctata
ctagataatgcattatcacctctactggaatttgaaaatgaaaagagaccagtaaaaatt
aaaaatggttttcctgaagttagtaataataaaagtgagaagacacaaagaggaacttta
aactcacactcagattctgaaaatgatggaaaaattaaatatttttctttgcaggaagga
acagacgaagccactttaagatttgctcttgttgaagcaatttttaatatcctaagtatt
aatgaagagagtttttacgccaaaaaaagtcgtacagcttcccttacaactccaaccctt
actcatagaataagcaactcctcagataattcactggaatcatcaatctactcaacacaa
caagactatcctgattcggctataaaaatattaccaagtgaatatgcaatcacatcccat
aaatttaaaccaaaattatcaactacttataaggaggaagttccaacttcaatcgatttt
gagagtgttaaaaaagaattttcagataatattgatttacaatatcatccaaaaggcgaa
actattgtcgaacagaacaacaatagtaaagggttattttacgtgatatctggaagtatc
gatgtaacttacaccaattctcctggcatggattatgttcctgaaatgaattcttctaat
aaagaatttaatgaagatttaaaaaaagttgaacaatttttatatacagttgaaagtgga
ggtatagctggatacctagcctcattagtcaattcgaaatcttttgttaatcttaaagcc
agaactgatgtctatgttggatttttatccaatcaaactttggaacgtttctacgacaaa
tactgtcttttgcatctcaggttagcagaaatattaaccacacttatttcgccaagaatg
ttaaagttagatcatgcattggaatggattcatctttcggcatctgaaactctatttaat
aaaggagacccagctaacggaatttatgtcatattaaatggaagggtcaggcaagtatcg
gacaaacattatttccaatcaccagaattggcacaaggtgaaagctttggcgaggttgaa
gtgttgacagcaatgaatcgtatgtcttcaatacaggcagtaagagaaacagaattagca
cgtatacccagaacgttatttggaatacttgctttagaacaaccttctattatgtttaga
atttcgagactggtcgcgcgcaaaatccttgatattaatttggggtctgacgttccaacc
agagtgacagctgataatggttataaatatgattttaacttgatgattccttccttaaac
ggaaatgcacataagggagctcatcctaaaaataaaaattcatacagaacaataactatt
ttacctgtaacagaaggacttcctgttaattcgtttgcgaataaattggtacaagctttt
agacaagtgggcagaaacacaattggactaaacatgaggacagcattaaatcatctagga
aggcatgcatttgataaattagctaaattaaagctaagtggttactttgccgaactagaa
gtaatgtatcaaaccgttgtttacatagctgactcaccggtaaactctagctggacaaat
acatgcatttcgcaaggtgactgtatactgttattagcggacgcaaatgattcagctgac
ataggggagtatgagttacttctacaaaaagttggaactacggcacggactgaattaatc
ctcttacatcctgaaagatatgtcgaacctggttctacctacaattggttaaaacaaaga
aattgggtagatgcacaccatcatatgcaatttcttgtcaatccattatcggaaagatta
aacatgcgttcccataataagaatgcgtcaagactcgctttggttgataggataatgaac
accgaatttagtaaattgacacaggaaaatatttcaaaatatgttcccgaatctataaaa
tcgaaggttgaaacaatttcaaggagaattagaggtagaagccatcaatattattcatca
agtgatcccaataaaaatgattttttgagacttgcaaggatcttgtcggatcaagcaatt
ggtgttgtattgggtggaggtggtgccaggggaatcagtcatttgggagttttacaagct
attgaagaacaaggtatcccaattgatttaattggaggaacttcaatgggtgcatttgtt
gcaggcttgtatgctaaggactatgatatagtcccaatatatggtaggttaaaaagtttt
tgtgctcgtattggttcattatggaggatgattggtgatttaacttggccagtaacttca
tacaccacaggtcatgagtttaatagaggtatttggaaaacttttggagacactagaatt
gaagatttttggatacaatattattgtaattctacaaatattactgaatctatccaggaa
atacattcattcggatatgcttggagatacatcagggcatcgatgtcacttgctggctta
ctgccaccattggaagcgaaaggatccatgctgttagacggtggatacgttgataactta
ccagtcgatgaaatgaaaggtagaggctgtgatattgtgattgccgttgatgtaggttca
gttgatgatcgtactccaatgaattatggtgattctttgaacgggttttggatcttgttc
aacaaatggaatcctttttcttcttaccctaatatcccaacaatggctgaaattcaaatg
agactaggttatgtgtcgtcagtgaacgcgttagaaagagctaaacgcacccccgggatt
atatacaccagaccaccagttgctgattttgcgacattagattttggcaaattcgaacag
atatataatgtcggtcttgattatggtaggagctatcttaaaaccttgattgaaaacaaa
aacatgccgtttattgcaggctcaaaagcgacgttgattgatacagcgattccagaattc
ttgtcacggagacgtaacagcatctaa

DBGET integrated database retrieval system