KEGG   Tetrapisispora phaffii: TPHA_0B01150Help
Entry
TPHA_0B01150      CDS       T02235                                 

Gene name
TPHA0B01150
Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
tpf  Tetrapisispora phaffii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TPHA_0B01150 (TPHA0B01150)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     TPHA_0B01150 (TPHA0B01150)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   TPHA_0B01150 (TPHA0B01150)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(259998..262070)
Genome map
AA seq 690 aa AA seqDB search
MNEKFSKLSLNSEAATESTNPVASAIENNGSSGSLKKPMYSSSGANASSSSQYSNINANL
QARVIAFQEQRVLKRSNSEKHVKTQNSSSSSPTESLSRKTSDKRNSEMIMNRTSVLSGSN
VTNVTTETTTIESQNIQQIINKPLPPLPPLNPPSSPEKSIASDVSKQVGDNLATMEKNTA
KNIPSGKKPKLKLPTGSDLNPNRTAPRRPPSIIRPVPGSPTTASPSITPNFNRKPSLMAR
RGLQLPGGGMSLKQLAKTPPENPKHQEFEPVPSNKHLSTKSETAGQRSNPGSLLNAVPRT
STSSSTDDRTDTAGTNPELENSVNKNIAINSTGSNSGGSSGSGGLFANFSKYVDIKSGSL
NFAGKLSLTSKGINFNNGSSSNITLDELEYLGELGHGNYGNVSKVLYKPTNVIMAMKEVR
LELDETKFRHILMELDVLHKCNSPYIVDFFGAFFIEGAVYMCIEYMDGGSLDKIYDYSSD
EKGIDEPQLAYITESVIRGLHELKEVHNIIHRDVKPTNILCSASQGTIKLCDFGVSGNLV
ASLAKTNIGCQSYMAPERIRSLNPDKSTYSVQSDVWSLGLSILELALGDYPYPPETFDNI
FSQLSAIVDGPPPKLPERFSPEAQEFVTLCLQKNPDRRPTYTQLLMHPWLLKYRDVDVNM
KEYITERLEKRKETLVDTEVRKPALHMGGL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaattttcgaaactatcgttgaattcagaagcagcaacggaaagtactaac
cccgtggcttctgctattgagaataatggttcttctggttccttgaaaaaaccaatgtac
agttcgtcaggtgccaacgcttcttcttcttctcagtatagtaatatcaatgctaatctg
caagctagggtcattgcatttcaagaacaaagggttttgaagagatctaatagtgaaaaa
cacgtcaagactcaaaattcaagctcgagcagtccaactgaaagtctttcaagaaaaact
agtgataagagaaatagtgaaatgatcatgaatcgtacatctgtcctgagtggaagtaat
gtaactaatgttactactgagactactaccattgaaagtcagaatattcaacagataata
aacaaaccactaccaccattgcctccattgaatcctccttcaagtccagagaaatcgata
gcttctgatgtcagtaagcaagtgggtgataatttagcaactatggaaaaaaataccgct
aagaatattccttccggtaaaaaacctaaattaaaactaccaacgggtagcgatttgaat
cctaatagaactgcaccacgtagaccaccctccataattaggccagtgcctggaagtcca
accacggcatccccttcaataactccaaattttaatagaaagccaagtttaatggctaga
agaggcttgcaactaccaggaggtggaatgtcattaaaacaattggcaaaaacacctccg
gaaaatcctaaacatcaagaatttgaacctgttccttctaataaacatctatcaaccaaa
agtgaaacggctggtcagaggtcaaatcctggttctttgttaaatgcagttccaagaacg
tcaacatcttcaagtactgatgatagaactgatacagctggaacaaatccggaattagag
aacagtgtaaataaaaatatagctatcaatagcactggaagtaattcaggaggttcaagt
ggttctggtggactgtttgcaaacttttcaaaatatgttgatatcaaatctggttctttg
aattttgcaggcaaactatctttaacatctaaaggtattaattttaataacggatcaagt
tcaaatattacattagatgaactggaatatttaggtgaattaggccatggtaattatggt
aatgtatcaaaggttctatataagcctactaacgtgatcatggctatgaaagaagtaaga
ttagaattagacgaaacaaaatttagacatatattgatggaattagatgttttacataaa
tgtaattcgccatatatcgtcgatttttttggcgcgttttttatcgaaggtgccgtttat
atgtgcattgaatatatggatggaggctctttggataaaatatatgactattcgtcagac
gaaaaaggtatagatgaaccacaattagcttatattacagagtctgtgattagaggttta
catgagctaaaagaagtacataacatcattcatagagatgttaaaccaactaatatttta
tgttcagcttcccaaggaacgatcaaattatgtgattttggtgtctccggtaatctagtt
gcgtctcttgccaaaactaatatcgggtgtcagtcatatatggctccagaacgtattaga
tctctgaatccagacaaatccacatactcggtacaatccgacgtttggtcattgggttta
agtattttagaattagcattaggtgattatccatatccaccagaaacatttgataatatt
ttctcacaattaagtgcaattgtagatggtcctccaccaaaacttccagaaagattcagt
ccggaggctcaagagtttgtcacattatgtttacagaaaaatccagatagaaggccaaca
tatactcaattgttgatgcacccatggttattgaaatatagagacgttgatgtcaacatg
aaagaatatatcaccgaaagattggaaaagagaaaagaaactttggtggataccgaagtt
agaaaaccagcattacatatgggaggtttatag

DBGET integrated database retrieval system