KEGG   Tetrapisispora phaffii: TPHA_0B01930Help
Entry
TPHA_0B01930      CDS       T02235                                 

Gene name
TPHA0B01930
Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tpf  Tetrapisispora phaffii
Brite
Protein phosphatases and associated proteins [BR:tpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TPHA_0B01930 (TPHA0B01930)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 11535119
NCBI-ProteinID: XP_003684299
UniProt: G8BPD4
Position
2:432107..432634
Genome map
AA seq 175 aa AA seqDB search
MGATSSKLIENLLEDTNFDRDEIERLRKRFMKLDSDSSGSIDKSEFMSIPGVSSNPLAAR
IMEVFDSDNSGDIDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGYISNGELFIVLK
IMVGNNLDDEQLQQVVDRTIMENDLDGDNHLSFEEFKSAIETTEVAKSLTLSYGV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccacttcttcaaaactaatagaaaatttattagaagataccaactttgatagg
gatgaaatcgaaaggctaagaaagagatttatgaaactagatagtgacagttctggctca
atcgataagagtgagtttatgagtattcctggtgtgtcatcgaacccattagcagccaga
attatggaagtatttgattcggacaacagcggtgatattgatttccaagaatttatcaca
ggtttatctatatttagtggacgtggtagtaaagatgaaaagcttagatttgcatttaaa
atatatgacatagataaggatggatatatatctaatggtgagttatttatagtgctaaaa
ataatggttggtaataatttagatgatgaacaattgcaacaagttgtcgatagaactatt
atggaaaatgatcttgatggtgataaccatttaagttttgaagaatttaaaagtgcaatt
gaaaccactgaagttgccaaaagtttaacgttatcttacggtgtatag

DBGET integrated database retrieval system