KEGG   Tetrapisispora phaffii: TPHA_0B02440Help
Entry
TPHA_0B02440      CDS       T02235                                 

Gene name
TPHA0B02440
Definition
(RefSeq) hypothetical protein
Organism
tpf  Tetrapisispora phaffii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:560189..561592
Genome map
AA seq 467 aa AA seqDB search
MNNIAIKRHTFKVFNQDFTVDKRFELIKEIGHGAYGVVCSARFIEATEDTTVAIKKVTNI
FSKTLLCKRSLRELKLLRHFRGHKNITCLYDLDIVFNSKTGEFNGLYLYEELMECDLYQI
IKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGY
SENPVENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSTGCILAEFLGGKPIFKGKDY
VNQLNRILQVLGTPPDETLRRIGSKNVQDYIHQLGHIPKVPFSNLYPQANPDALDLLEKM
LAFDPQDRITVNEALEHPYLSVWHDPSDEPICLEKFEFSFETVNEMDMLREMVIQEVQDF
REFVRKPLIEENENGLVNSPSQSQQSEQDIISNVQMQQQLDSASSNNMAGDFTSELQSNN
LPKTRDNDFPPSPQENNRSAITSNNNQFNGIFDLEKELEFGLDGKYL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatattgctattaagagacatacctttaaggttttcaaccaggattttactgtc
gataaaagatttgaactgatcaaagagattggacatggtgcttatggtgtcgtatgctcg
gctaggtttatagaggctacagaagacacaactgttgccattaagaaagttacaaacatt
ttttcaaaaaccctactttgtaaaagatcgttacgtgaattgaaattattgaggcatttc
agaggccataaaaatatcacttgtctttatgacttagatattgtgtttaattcaaagacc
ggtgaattcaacggtttgtatctttatgaagaattgatggaatgtgatctatatcagatt
attaaatcaggacaacctttaactgatgcacattaccaaagttttacataccagatatta
tgtggtctaaaatatatacattcagcagatgtgctacatcgtgatttaaaaccaggtaat
ttgttagtcaatgctgactgtcaattaaagatttgcgattttggtttagcaagaggttac
tctgaaaatccagtagaaaataatcaatttttaactgaatatgttgccaccagatggtat
agagccccagagattatgttaagttatcaaggttacacgagagccattgatgtttggtca
accggttgtattttggcagaatttttgggtggcaaaccaattttcaaaggtaaagattac
gtaaatcaactaaacagaatcttacaagtcttgggtactccaccagatgaaacattgagg
aggatcggttcaaagaatgtacaagattatatacatcaattaggtcacattccaaaagta
ccattttctaacttatacccccaagccaatccagatgcattggatttattagaaaagatg
ttagcatttgatccccaagatagaattacagttaatgaagcattagaacacccatattta
tctgtctggcatgacccttctgatgaacctatttgtttggaaaaatttgaatttagtttt
gaaacagttaatgaaatggatatgttaagagaaatggtaattcaagaagtccaagacttt
agagaatttgtaagaaaaccattaattgaagaaaatgaaaatggcttagtcaattctcct
tcgcaatcacaacaatctgaacaagatataatatccaatgttcaaatgcagcaacagtta
gattctgcatcatctaataatatggccggtgatttcactagtgaactgcaatctaataac
ttacctaaaactcgcgataatgatttcccacctagtccacaagaaaataatagatcagca
atcactagtaataataatcaatttaatggtattttcgatctagaaaaggaattggaattt
ggtctggatggtaaatatttataa

DBGET integrated database retrieval system