KEGG   Tetrapisispora phaffii: TPHA_0B02440Help
Entry
TPHA_0B02440      CDS       T02235                                 

Gene name
TPHA0B02440
Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
tpf  Tetrapisispora phaffii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TPHA_0B02440 (TPHA0B02440)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TPHA_0B02440 (TPHA0B02440)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   TPHA_0B02440 (TPHA0B02440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:560189..561592
Genome map
AA seq 467 aa AA seqDB search
MNNIAIKRHTFKVFNQDFTVDKRFELIKEIGHGAYGVVCSARFIEATEDTTVAIKKVTNI
FSKTLLCKRSLRELKLLRHFRGHKNITCLYDLDIVFNSKTGEFNGLYLYEELMECDLYQI
IKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGY
SENPVENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSTGCILAEFLGGKPIFKGKDY
VNQLNRILQVLGTPPDETLRRIGSKNVQDYIHQLGHIPKVPFSNLYPQANPDALDLLEKM
LAFDPQDRITVNEALEHPYLSVWHDPSDEPICLEKFEFSFETVNEMDMLREMVIQEVQDF
REFVRKPLIEENENGLVNSPSQSQQSEQDIISNVQMQQQLDSASSNNMAGDFTSELQSNN
LPKTRDNDFPPSPQENNRSAITSNNNQFNGIFDLEKELEFGLDGKYL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatattgctattaagagacatacctttaaggttttcaaccaggattttactgtc
gataaaagatttgaactgatcaaagagattggacatggtgcttatggtgtcgtatgctcg
gctaggtttatagaggctacagaagacacaactgttgccattaagaaagttacaaacatt
ttttcaaaaaccctactttgtaaaagatcgttacgtgaattgaaattattgaggcatttc
agaggccataaaaatatcacttgtctttatgacttagatattgtgtttaattcaaagacc
ggtgaattcaacggtttgtatctttatgaagaattgatggaatgtgatctatatcagatt
attaaatcaggacaacctttaactgatgcacattaccaaagttttacataccagatatta
tgtggtctaaaatatatacattcagcagatgtgctacatcgtgatttaaaaccaggtaat
ttgttagtcaatgctgactgtcaattaaagatttgcgattttggtttagcaagaggttac
tctgaaaatccagtagaaaataatcaatttttaactgaatatgttgccaccagatggtat
agagccccagagattatgttaagttatcaaggttacacgagagccattgatgtttggtca
accggttgtattttggcagaatttttgggtggcaaaccaattttcaaaggtaaagattac
gtaaatcaactaaacagaatcttacaagtcttgggtactccaccagatgaaacattgagg
aggatcggttcaaagaatgtacaagattatatacatcaattaggtcacattccaaaagta
ccattttctaacttatacccccaagccaatccagatgcattggatttattagaaaagatg
ttagcatttgatccccaagatagaattacagttaatgaagcattagaacacccatattta
tctgtctggcatgacccttctgatgaacctatttgtttggaaaaatttgaatttagtttt
gaaacagttaatgaaatggatatgttaagagaaatggtaattcaagaagtccaagacttt
agagaatttgtaagaaaaccattaattgaagaaaatgaaaatggcttagtcaattctcct
tcgcaatcacaacaatctgaacaagatataatatccaatgttcaaatgcagcaacagtta
gattctgcatcatctaataatatggccggtgatttcactagtgaactgcaatctaataac
ttacctaaaactcgcgataatgatttcccacctagtccacaagaaaataatagatcagca
atcactagtaataataatcaatttaatggtattttcgatctagaaaaggaattggaattt
ggtctggatggtaaatatttataa

DBGET integrated database retrieval system