KEGG   Tetrapisispora phaffii: TPHA_0B02700Help
Entry
TPHA_0B02700      CDS       T02235                                 

Gene name
TPHA0B02700
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TPHA_0B02700 (TPHA0B02700)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TPHA_0B02700 (TPHA0B02700)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TPHA_0B02700 (TPHA0B02700)
Lipid biosynthesis proteins [BR:tpf01004]
 Desaturase
  First
   TPHA_0B02700 (TPHA0B02700)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:620423..621889
Genome map
AA seq 488 aa AA seqDB search
MSQTHTIEALDVASANVIATGLHKKTKRVVNGLGSLMGSKEMVDLTNESINTTNVNLPSS
LSSSSSTTTNRKHISEQPWTLHNWHEHINWLNFVLVVLIPAIGWYLALSGLIPLKLKTAL
FSVFYYALGGASITAGYHRLWSHRSYSARWPLRLFFALFGSASVQGSAKWWGHSHRIHHR
YTDTNRDPYDARKGLWYSHMGWMLLKPNPKYKARADIQDLNDDWIVRFQHRHYIPLMLIF
AFILPSIIAGRYFNDYLGGFLYAGIIRVFCIQQATFCINSMAHYIGAQPFDDKRTPRDNW
LTALVTFGEGYHNFHHEFPSDYRNAIKWYQYDPTKVIIYLTSLVGLSYDLKTFSSLAIKQ
ALVQQEQKKLDKKKNALTWGPSLTNLPKWDKAQFIEESKTNGNLIVISGIVHDVKGYITE
HPGGQLLIKSALGKDATSAFNGGVYRHSNAATNVLANLRVAVIVESEESALKFAARRGEH
YYDEKKTI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaactcatacaatagaggcgctagacgtcgcaagcgcaaatgttattgctact
ggtcttcacaagaaaactaaaagagtcgttaatggattaggttcattgatgggctcaaaa
gaaatggtcgatttaacaaatgaatctatcaacactacaaatgtcaatttgccaagttca
ttatcgtcgtcttcatcaacaacaacaaatagaaaacatatttccgaacaaccttggact
ctacacaattggcatgaacatattaattggctaaattttgtcttagtggttttaatccct
gcaataggctggtatttggctctttctggtttaattccattgaaattgaagactgctttg
ttctcggtattttactacgctcttggtggtgcttcaatcactgcaggttatcataggcta
tggtcccatagatcttatagtgcaagatggcctctaagattattttttgcattgttcggt
tcggcttctgtgcaaggttctgcgaaatggtggggccattcacacagaattcatcatcgt
tacaccgatacaaacagagatccttatgatgcaagaaaaggcttatggtattctcacatg
ggttggatgctgttgaaaccaaacccaaaatataaagcaagagctgatattcaagatcta
aatgacgattggatcgttagatttcaacatagacattatattcctttgatgttaattttt
gcatttatattaccatcaatcatcgcaggtagatacttcaatgattatttaggtgggttt
ttatacgctggtataattagggtattttgtatccagcaagctactttttgcattaactcg
atggctcattacatcggtgctcaaccatttgatgataaaagaaccccaagagataattgg
ttaactgcgttagtcacatttggagaaggttatcataacttccatcatgagttcccaagt
gattatagaaatgcaattaaatggtatcaatatgacccaacaaaagttattatttattta
acgtctttagttggtttatcatacgatttaaagaccttctcaagtttagcgatcaaacaa
gcattagtacaacaggaacaaaaaaaattggataaaaagaaaaacgcattaacttggggt
ccttccttaacaaatttaccaaagtgggataaggctcagttcattgaagaatcaaagact
aacggtaacttaatcgttatttccggtatcgttcatgacgttaaaggttatatcaccgaa
catcctggtggacaactattaatcaaaagtgcactaggaaaagatgctacttctgcattc
aatggtggtgtctacagacactcaaacgctgccaccaatgtgttagctaatttaagagtt
gccgtgatagtagaaagcgaagaaagtgcattgaagtttgcagccagaagaggagaacat
tattatgacgaaaagaagaccatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system