KEGG   Tetrapisispora phaffii: TPHA_0B03910Help
Entry
TPHA_0B03910      CDS       T02235                                 

Gene name
TPHA0B03910
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tpf  Tetrapisispora phaffii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TPHA_0B03910 (TPHA0B03910)
Enzymes [BR:tpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TPHA_0B03910 (TPHA0B03910)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TPHA_0B03910 (TPHA0B03910)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(922610..924733)
Genome map
AA seq 707 aa AA seqDB search
MSEVPENVKGVVDFDSWLKPWANVLSERRYLADKYKYDIQHSTSDGKEISLKEFARDSYK
TYGLHVDSQTKEIVYQEWCPNAAKAYLIGDFNNWNESTHELTRFDDFGNFKIVVKPIVEN
GSTSYAIKHDSKIKVMFVLNNGEKIYRLPAWITRSTQPDKETVKKYGPIYEGRFWNPENP
YIFKSKRPTFNLTKDSLRIYEAHIGISSPEPTVASYKNFTQNVLPRIRDLGYNCIQLMAI
MEHAYYASFGYQVTNFFAISSRFGTPEDLKELIDTAHSMGIIVLLDVVHSHASKNVEDGL
NMFDGSDHHMFHSLTSGRGEHPLWDSRLFNYGKFEVQRFLLANLAFYIDVYQFDGFRFDG
VTSMLYVHHGVGENGAFSGDYNEYLSKERSHVDHEALAYLMLANDLVHELLPNQAITIAE
DVSGYPTLCLPRDIGGVGFDYRLAMALPDMWIKLLKEKKDEDWDMGHIAFTLTNRRHGEK
VVAYCESHDQALVGDKTLAFWLMDAEMYTGMTILKETTPVIDRGIALHKMIRLITDSLGG
EAYLNFEGNEFGHPEWLDFPNVNNNDSYHYARRQFNLVDDNLLRYQHLYNFDKAMQHTEG
SYQWLNTPQAYISLKHEGDKVIVYERNGLLFLFNFNPKKSFNDYRIGVEVPGKYKIILNT
DKPEFGGHNRIDEKSSFFTTNEKWNDRNNYLQVYIPSRTAMILALDK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagttccagaaaatgttaaaggtgttgtagacttcgactcttggttgaaacct
tgggcaaatgttttgtcagaaagaagatacttggctgataaatataagtatgatattcaa
cactcgacaagtgatgggaaagagatctcgttgaaggagtttgcaagagactcttataag
acgtatgggctacatgtggactcgcaaacaaaagagattgtttatcaagaatggtgtcca
aatgctgcaaaggcttatttaattggtgattttaataactggaatgaatccacacacgag
ttgactaggtttgatgattttggaaattttaagattgtagtgaaacccattgttgaaaat
ggtagtacgtcttatgcaattaaacacgattctaaaatcaaggtaatgtttgtacttaat
aacggtgaaaagatttatagattgcctgcttggatcacaagatctacacaaccagacaaa
gaaaccgtcaaaaagtacggtcctatttatgaaggtagattttggaatcctgagaaccct
tatatattcaaaagtaaaagaccaacttttaacttaacgaaggattcattaagaatttat
gaagctcatattggtatctcttcaccagagccaacagttgcctcttacaaaaacttcacc
caaaatgttttaccaagaattagagatttaggttacaattgtattcaactaatggcaata
atggaacatgcctactatgcatcatttggttatcaagttacaaacttctttgcgatctct
tcaagatttggtacccctgaggacttgaaagaattgattgatactgcacattctatgggg
ataatagttttattggatgttgtccatagtcatgcctcaaaaaatgtagaagatggttta
aatatgtttgacggttctgatcatcatatgttccattctcttacttcaggcagaggtgag
catccattatgggattcaagattatttaactacggtaaatttgaagtccaaagattttta
ttggcaaatctagcattctatatcgatgtttatcaattcgatggcttcagatttgatggt
gtaacctccatgttatatgttcatcatggtgttggcgaaaatggtgcctttagtggtgat
tacaacgaatatttatctaaggaaagatcacacgtggatcatgaagccttagcttatctg
atgttggccaatgatttagtgcatgagttgttaccaaatcaagccataacaatcgcagag
gatgtttcaggatacccaacactatgtctaccaagagatatcggtggcgtaggctttgac
tatagactggcaatggctttaccggatatgtggattaagttattaaaggaaaagaaagat
gaagattgggacatgggacatatagcatttactttgaccaatagaagacatggtgaaaaa
gtagttgcatactgtgaatcgcatgaccaagctttggttggagataagacgttagcattt
tggttaatggatgccgaaatgtatacaggcatgacaatattgaaagaaactacaccagtg
attgaccgtggtattgcactacataaaatgattagattgattactgattctttaggtggt
gaagcgtatttgaattttgaaggtaatgaatttggacaccctgagtggttagattttccg
aatgtgaacaacaatgacagttatcattatgctcgtaggcaattcaacttagtggatgac
aatttgttgcgttatcaacatttgtataactttgataaagcgatgcaacatacagaaggg
agctaccaatggttgaatactccacaagcgtacatctcattaaaacatgaaggcgataaa
gttattgtttatgaaagaaatggattgttatttttgtttaatttcaatccaaagaaaagc
ttcaatgactatagaattggtgtcgaggtgccaggtaaatataaaattattttgaacaca
gacaaaccagagtttggtggtcataacagaattgatgaaaagtccagtttttttaccact
aatgaaaaatggaatgatagaaacaactatctacaagtatatattccaagtagaactgca
atgattttagcgttagataaatga

DBGET integrated database retrieval system