KEGG   Tetrapisispora phaffii: TPHA_0B04860Help
Entry
TPHA_0B04860      CDS       T02235                                 

Gene name
TPHA0B04860
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TPHA_0B04860 (TPHA0B04860)
Enzymes [BR:tpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TPHA_0B04860 (TPHA0B04860)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TPHA_0B04860 (TPHA0B04860)
  Exosomal proteins of colorectal cancer cells
   TPHA_0B04860 (TPHA0B04860)
  Exosomal proteins of bladder cancer cells
   TPHA_0B04860 (TPHA0B04860)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1139423..1141051
Genome map
AA seq 542 aa AA seqDB search
MLLNKKTLFPLASLLAHFVAANEEAIAPEDSQVVKLGKDNFVDFVKDNHLVMAEFFAPWC
GHCKKLAPEYVKAADTLQSKDVALAQIDCTDNQDLCMGQGIRGYPTIKIFRDGDYENATD
YNGARTAEAIVDHMIKLTLPVVIELEDADDLEDYIEDVAQYGSIFVNKGMADYNETFYKT
AKKAFGKHTFINVPLEKGETPELTFYSKSLEKPITFDGDLKQLVESDDYLIRWASIESLP
AFGEINAETYSGYYAAELPMGYFFFNDDEDVKTVEKLFESLAKTYKGKILFAKLDGSKFG
RHADALNMKQQFPLFVIHDSKLNLKYGLPQLSDEEFEKLDGKRITLNSKQVKKLVKDFVS
GKAEPTVKSEPIPEVQESNVTKIVGYTHEDIVQDAKKDVLVKYYAPWCGHCKKLAPIYED
LANLLQSEKSTKDKFVIAEVDATLNDISSVELEGYPTIILYPANKKDEPVRFESQRDITN
FLTFLEENSTNKLKATSLVKAYEAMIAEQKAAEAAAKAAAEEEDDDEDDEDEDEDEIEHD
EL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgctattgaataagaaaactttgtttcctttagccagtctattggctcacttcgttgct
gccaatgaagaagccattgctccagaagactcacaagtcgtcaagttaggcaaggacaac
ttcgtcgacttcgttaaggacaaccatttagtgatggccgaattcttcgcaccatggtgt
ggtcattgtaagaaattggctccagaatacgttaaagctgctgatactttgcaaagcaaa
gacgtagctctagctcagatcgattgtaccgataatcaagatctatgtatgggccaaggt
atcagaggttatccaaccattaagatcttcagagacggtgactatgaaaatgctaccgac
tacaacggtgctagaactgcagaagctattgttgatcatatgattaaactaactttacca
gtggtcatcgagttagaagatgctgatgatttggaagattacatcgaagacgttgctcaa
tatggttctatttttgttaacaaaggtatggccgactataatgaaaccttctacaagact
gctaagaaagcattcggtaaacatactttcatcaacgttccattggaaaaaggtgaaact
ccagaattgactttctactcaaaatctcttgaaaaaccaatcaccttcgatggtgatcta
aaacaattagtcgaaagtgacgattacttgattagatgggctagcatcgaatctttgcca
gctttcggtgaaatcaatgctgaaacttactccggttattacgctgctgaattaccaatg
ggttactttttcttcaacgacgatgaagacgtcaaaaccgttgaaaaattatttgaatcc
ttggcaaagacttacaaaggtaagatacttttcgctaaattagatggttccaaattcggt
agacacgctgatgctctaaacatgaaacagcaattcccattatttgttatccatgactct
aagcttaacttaaaatatggtctcccacaattatctgatgaagagttcgagaaattagac
ggtaaacgtattaccttaaatagcaagcaagtaaagaaattagttaaagatttcgttagc
ggcaaagctgaaccaactgtcaagtctgaaccaattccagaagttcaagaatctaacgtc
actaagatcgttggttacacccacgaagatattgttcaagatgccaagaaggatgtctta
gttaaatactatgctccatggtgtggtcactgtaagaaattagctccaatctacgaagac
ttagctaacttactacaaagcgaaaaatctactaaggataaattcgttattgctgaagtt
gatgccactttgaacgatatttcttctgttgagttagaaggttatccaaccatcattcta
tatcctgctaacaagaaggatgagccagtcagattcgaatctcaaagagacattaccaac
ttcttgactttcctagaagaaaactccactaacaaattaaaggctacttctttagttaag
gcgtacgaagccatgattgctgaacaaaaagctgccgaagctgctgctaaggctgctgct
gaagaagaagatgatgacgaagatgatgaagatgaagatgaagatgaaatcgaacacgat
gaattgtaa

DBGET integrated database retrieval system