KEGG   Tetrapisispora phaffii: TPHA_0C00780Help
Entry
TPHA_0C00780      CDS       T02235                                 

Gene name
TPHA0C00780
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TPHA_0C00780 (TPHA0C00780)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TPHA_0C00780 (TPHA0C00780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(152599..154395)
Genome map
AA seq 598 aa AA seqDB search
MPKDTNEREPRTRSIGNVARSYRGASRSRSQSGNKSRRDSLTILSGPTRSIRTINIESDD
DYSSTASPSTYSNHSDNETENPDSRDSMGSLSSKLQYLKLQGDSGSSGASEALEVPFVKV
TLDPTLPRDYLKKDILTIIDSLRIPKWHLRGSLGKNTIDVDNLKLTQITGAMTNMIFKVA
YPRLPSLLLRVYGSNNDTIIDREYELQKLARLSQHHIGPSLYGCFENGRFEQFLENSQTL
KKNDVRSWRISQRIARRMKELHTGVPLLRSERGSRPVSLKLIDKWISVIEDVGATWLTEK
SNVTDIIQAKDWDTFKKVVSRYEMWLLDPNYSKTSEKLVFCHNDTQYGNLLFSSPMCETP
DSGDYTPVAQNSSSSISSLFPSASNISLHEIINPSKEDKIEDNKLIVIDFEYAGANPAAF
DLANHLSEWMHNYNCDTPHKCEPQEYPSKEQVLNFLYSYVSHLRGGAKTSIDEDVKNLYN
SIIRWRAAAQLFWSIWAVIQSGKLVKENTTIVNKEEIGPGGEKYIIKTEELDDGLVKEES
IQSEEIESLTGVDIGSFDYLSFCRHKIALFWSDMIQLGLANKEDCTIQEAISLDTKFL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagacacaaatgaaagagaaccaaggactcgttccattggaaatgttgcaaga
agttatcgtggtgcgtctaggtcgagatcgcagtctgggaataagtctagacgggattca
ttaactattctaagtgggcctacgcgttctattcgtaccatcaatattgagtcggatgat
gactattcttcgactgcttcgccgtcgacgtattcgaatcatagtgataacgaaacagag
aatcctgattctagggattcgatggggtctctctcgtcaaagttacagtatttgaagtta
caaggagattctggcagttccggtgccagtgaagcacttgaggtaccgttcgttaaagtc
acattagatcctacactaccaagagactacttaaagaaagatatcttaacgattattgat
tcgttgagaatcccgaaatggcatctgagaggttctttgggtaaaaataccattgatgtt
gataatttgaagttgacgcaaattaccggtgctatgacaaatatgatttttaaagtagca
tacccaagattaccgtcattattgcttcgcgtatacggtagtaacaacgatacaattata
gatagggagtatgaattgcaaaaactcgccagattatctcaacaccatatcgggccttca
ttatatggttgttttgaaaatggcagatttgaacagttcctggaaaattcacagacttta
aagaagaacgatgtgagaagttggaggatctctcaaagaattgcacgtagaatgaaggaa
ttacacaccggtgtacctctattaagatcggaaagaggtagcagacctgtatctttaaag
ttgattgacaaatggatcagtgttattgaagatgttggagcaacatggttaacagaaaaa
tcaaatgtcacagatattatccaagcaaaggattgggatacgtttaaaaaggtagtttca
cgttacgagatgtggttgttagatccaaattatagtaagacttctgaaaaattggtcttc
tgccataacgacacccaatatggtaacttgttatttagttctccaatgtgcgaaacacca
gatagcggagattacacacctgttgcacaaaattcttcatcttcaataagttctttattc
ccttcagcatctaatatatcactacatgaaataattaatccttcgaaagaagataaaatt
gaagataataaacttattgtcattgattttgagtatgcaggtgccaatcctgcggctttc
gatttagctaaccatttaagtgaatggatgcataattataactgtgacacaccacataaa
tgtgaacctcaagaatatccatccaaggagcaagttttaaattttttatattcttacgta
tcacatctaagaggtggtgccaaaacttcaattgacgaagatgtgaagaacctgtacaat
tcaattatcaggtggcgagcagcagcacaattattttggagtatttgggctgtcatccag
agtggcaaattggtcaaagaaaatacgactatagtaaataaagaagaaattggtccaggg
ggagaaaaatatattattaaaacagaagaattagatgatggacttgtaaaagaagaatct
attcaaagtgaagaaattgagagtctaacaggtgttgatattggaagttttgattatctc
agtttctgcagacataaaatagcattattctggagtgacatgattcaattaggtttagct
aacaaagaagattgcaccattcaagaagctatatctttagatactaaatttttatag

DBGET integrated database retrieval system