KEGG   Tetrapisispora phaffii: TPHA_0C01210Help
Entry
TPHA_0C01210      CDS       T02235                                 

Gene name
TPHA0C01210
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tpf  Tetrapisispora phaffii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TPHA_0C01210 (TPHA0C01210)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TPHA_0C01210 (TPHA0C01210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(277366..278214)
Genome map
AA seq 282 aa AA seqDB search
MEESAIKIVLAVLLLAVGTYYSLQLGKQFKPKATLVKGQYKKFPLIRKTILSHNSAVYRF
KLPTEDSILGLPVGQHITVKAVINEKTIIRSYTPTSLDTDSRGFFELLIKSYENGNMSKN
FAELELNDTIELSGPKGFYNYSPNCRKELGMVAGGSGITPMYQIIKAIAQNPNDKTKVSL
IYGNVAEKEILLKKQLDDLVATKPEQFRVYYVVDNPSEDWTGGVGYITADVMKEYLPAPG
HGVQLLVCGPLPMVSSVKRCAVALGFAKAKPVPKMEDEVFVF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaagtgctattaaaattgttttggctgtgcttctattagcagtgggtacatat
tattccttacaattaggtaaacaattcaaaccaaaggctacattagttaaaggtcaatat
aagaagtttccattgatcagaaagacgatcttgtcacataatagtgctgtttaccgcttc
aaactgccaactgaagattctatcttgggtctacctgttggtcagcacatcactgtcaag
gctgtaataaatgaaaagacaattatcagatcctacactccaacttcattagacactgat
tctagagggtttttcgagctgttgattaaatcttacgaaaatggtaacatgtcaaagaat
tttgctgaattggaacttaatgacactattgaattgagtggtccaaagggtttctacaat
tactcaccaaactgccgtaaggaacttggtatggttgcaggtggttctggtattacgcca
atgtatcaaataataaaagcaattgctcagaatccaaatgataaaactaaagtatcatta
atttatggtaatgttgctgagaaggaaattttattgaaaaaacaattagatgacttagtt
gctaccaaaccagagcaatttagagtttactatgtcgttgataacccaagtgaagattgg
actggtggtgtgggttacattactgcggatgtcatgaaagaatacttaccagccccaggt
catggtgtccaattgttagtctgcggcccactgccaatggtatcaagtgttaaaaggtgt
gccgttgccctaggttttgcaaaagccaagccagttccaaaaatggaagatgaagttttc
gttttttag

DBGET integrated database retrieval system