KEGG   Tetrapisispora phaffii: TPHA_0C02060Help
Entry
TPHA_0C02060      CDS       T02235                                 

Gene name
TPHA0C02060
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:464776..465162
Genome map
AA seq 128 aa AA seqDB search
MSAKAEKKPASKAPAAAKKTPTAGSDGKKRTKARKETYSSYIYKVLKQTHPDTGISQKSM
SILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVT
KYSSSTQA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaaagctgaaaagaaacctgcctccaaagccccagctgctgctaagaagacc
ccaactgctggttcagatggtaagaagagaactaaggctagaaaggaaacttactcttcc
tacatttacaaagttttaaagcaaactcacccagacaccggtatttctcaaaaatctatg
tctattctaaactcttttgttaacgatattttcgaaagaattgccacggaagcctctaag
ttagctgcttacaacaagaagtctactatctctgctagagaaattcaaactgctgtcaga
ttaatcttaccaggtgaattagccaagcatgctgtctctgaaggtactagagctgtcacc
aaatattcttcttctactcaagcttaa

DBGET integrated database retrieval system