KEGG   Tetrapisispora phaffii: TPHA_0C02770Help
Entry
TPHA_0C02770      CDS       T02235                                 

Gene name
TPHA0C02770
Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
tpf  Tetrapisispora phaffii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TPHA_0C02770 (TPHA0C02770)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TPHA_0C02770 (TPHA0C02770)
Peptidases [BR:tpf01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TPHA_0C02770 (TPHA0C02770)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:604690..607602
Genome map
AA seq 970 aa AA seqDB search
MMNTNSEKVLHFDPIVRLSEIADKFISQDNKYTNMKSSLQECIDTLANYQDECKKLKKLS
VKNQQDDSDKKDINLLGDIYSLYESAYIYYKIIHIIVLNRIPNLQEFAHSKSQNATKEEE
ELLKIYNMLVKTLLNDDKIQHIKTYLRNNQVTKNHKTTEEYKKDINKELINTELFNLPLS
GSGISAIQLNHLIQIYNDTLLVIDVRPRMEFEESHIKCKNIICIEPVSFNESFTDLELQK
KSMITSPSDEVKTFAKKDTFNYIVICTDTDEKKQFYLHQQLVLLDLLMNKSFTKPMFQKN
VKIFILEKGFKNWVYKKGECEASSPITDVVKPDFTTTRIQDNNKLIEKPEIQKQSGDSIY
IEGNTSALNLQKLPELTANVGYAKDNSMRVMMNSSSNFSYSKDYHLPLQQSPLPQRTPSF
KSLFNRNGSIPTVSQNGNPAASPYMTKYSNSGQYNINSESPHKSPSTSQITNAYSLPVNS
KPSINLNISRYPETPNLSTVSTNNMNIHNNTMGPISPINSRVITPSSRLDESSSPGHRLV
PINSSELYNIKSIENYKPSSGSTMKPLLLKSATSKPPSQSLPSLPQLPSASDTLKSYTNS
DKDYDFSIGLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARN
FARLINTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDLQQDSQEFCQFLLDGLH
EDLNQCGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTDFSVIVDQFQGQYASQLR
CKVCGGTSTTYQAFSVLSVPVPRGKSCNIIDCFNEFTKVENLETDELWACPHCKKKQPST
KKLTITRLPRNLIIHLKRFDNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGVTEELPT
RGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPLKNSYECITSNAY
VLFYHRVYGV
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacactaactcagaaaaagtgttacactttgatcccattgttagattgtcagaa
attgctgataagtttatttcacaagataataaatatactaatatgaaatcctccttacag
gaatgtattgacacattagcaaactatcaagatgaatgtaagaaattaaagaaattaagt
gttaaaaatcagcaagatgattctgacaaaaaagacatcaacttattaggtgacatttat
tcattatatgaatcagcatatatttactataagataatacatataattgtgttaaacaga
atacctaatttacaagaatttgctcactccaaaagtcaaaatgcaacaaaagaagaagaa
gaactattgaaaatttataacatgctagtgaagaccttattaaatgatgacaaaatacag
catatcaagacatatttaagaaacaatcaagtcacaaagaatcacaaaacaactgaggag
tataagaaagatattaacaaggaattaataaatactgaattatttaatttaccattatcg
ggatcaggaatctctgctattcagttaaatcatttaattcaaatatataatgacacacta
ttagtcatcgatgtacgaccaagaatggaatttgaagaatctcatattaaatgtaaaaat
attatatgcattgaacctgtatcattcaatgaatcttttacagacttagaattacaaaaa
aaatcaatgattacttcacctagtgatgaggttaaaacttttgctaaaaaagataccttc
aattatatcgtaatatgtacagacactgatgagaaaaaacaattttatctacaccaacag
ttagtgttattagatttattaatgaacaaatcattcactaaaccaatgtttcaaaaaaat
gtaaaaatattcattttagagaaagggtttaaaaattgggtctacaaaaaaggagaatgt
gaggcatcctcaccgattactgatgtagttaaacctgattttacaactactagaattcaa
gataataataaattaattgagaaaccagagatacagaagcaaagtggggatagtatatat
attgaaggaaacacttcagctcttaatctacaaaaattgcctgaattgaccgctaatgtg
ggctatgccaaggataattcgatgagagtgatgatgaattcttccagtaatttcagctac
tctaaagattatcatttaccgttacagcaatccccgttaccgcaaaggacaccgagtttt
aagagcctattcaatagaaatggttctattccaacagtttcccaaaatggaaatcctgca
gcttcaccatatatgacaaagtattcaaattcaggtcaatataatataaactctgaaagc
cctcacaagtccccgtccacatctcaaattaccaatgcgtattccttacctgtcaattca
aaaccatcgataaatttgaatatatcacgatatccagaaactccaaacttatcaactgtt
tctactaataatatgaatattcataataataccatgggccctatttctcctatcaatagt
agagtaataaccccgtcatcgagactcgatgaatcatcgtctcctggtcatagacttgtt
cccatcaacagttcagaattgtataatataaaaagcattgaaaattacaaaccaagtagc
ggatctacaatgaaacccttattattaaaatcggctacgtcaaaaccaccaagtcaatcg
ttaccttcattgcctcagttaccttcagcatcagacacattgaaatcatatactaattct
gacaaggattacgatttttctataggtttggaaaacatgggtaattcatgttatctaaat
tgtatcattcaatgtttattaagttctcatgaatttacaagaatatttttaaataattca
tatgagaaacatatcaatttaaagagtaaattaggctcgaagggggtattggcaaggaat
tttgcgagactaataaatacaatgtatactgaagggtctgaacagagtaagaatgacaga
aatggtccagtaaaacctgctcagtttaaattggcttgtgggtctataaattcaattttt
agaagtgatttgcaacaagacagtcaagaattttgtcaattcttactagatggattgcac
gaagatttaaaccaatgtggtgcaaaccctccattgaaggaactttcaccgaacgctgaa
aagatgagagaaaaattgtctctgagaattgcttcatctattgaatgggagagatatcta
actaccgattttagcgtaatagttgatcaatttcaaggacaatatgcctcgcaactaaga
tgtaaggtttgtggaggaacttcgactacgtatcaggcattttcggtattatccgtacca
gttccacgtggtaaatcgtgtaacataattgattgttttaacgaatttaccaaggtagag
aatttagaaacagatgaattatgggcatgtcctcattgtaaaaagaagcaaccatccact
aaaaaattaacgatcacaaggctgccaagaaatttaattattcatctcaagaggttcgat
aacatgttaaataagaataatatttttgttaaatatccatttttattggatctaacgccc
tattgggcgaatgattttgatggcaggctgccgccgggtgtaacagaggaattgccaacc
agaggccaaataccaccattcaattataagttaaatgcagttgcagcacattttggaagt
ttatatggtgggcattatacatcttatgttgataaaggtaagtttggatggcgttatttt
gatgatactaaaatcagacctttgaagaattcatatgaatgcataacttctaatgcgtac
gttttattctatcacagagtgtatggagtttag

DBGET integrated database retrieval system