KEGG   Tetrapisispora phaffii: TPHA_0C02770Help
Entry
TPHA_0C02770      CDS       T02235                                 

Gene name
TPHA0C02770
Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tpf  Tetrapisispora phaffii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tpf04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:604690..607602
Genome map
AA seq 970 aa AA seqDB search
MMNTNSEKVLHFDPIVRLSEIADKFISQDNKYTNMKSSLQECIDTLANYQDECKKLKKLS
VKNQQDDSDKKDINLLGDIYSLYESAYIYYKIIHIIVLNRIPNLQEFAHSKSQNATKEEE
ELLKIYNMLVKTLLNDDKIQHIKTYLRNNQVTKNHKTTEEYKKDINKELINTELFNLPLS
GSGISAIQLNHLIQIYNDTLLVIDVRPRMEFEESHIKCKNIICIEPVSFNESFTDLELQK
KSMITSPSDEVKTFAKKDTFNYIVICTDTDEKKQFYLHQQLVLLDLLMNKSFTKPMFQKN
VKIFILEKGFKNWVYKKGECEASSPITDVVKPDFTTTRIQDNNKLIEKPEIQKQSGDSIY
IEGNTSALNLQKLPELTANVGYAKDNSMRVMMNSSSNFSYSKDYHLPLQQSPLPQRTPSF
KSLFNRNGSIPTVSQNGNPAASPYMTKYSNSGQYNINSESPHKSPSTSQITNAYSLPVNS
KPSINLNISRYPETPNLSTVSTNNMNIHNNTMGPISPINSRVITPSSRLDESSSPGHRLV
PINSSELYNIKSIENYKPSSGSTMKPLLLKSATSKPPSQSLPSLPQLPSASDTLKSYTNS
DKDYDFSIGLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARN
FARLINTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDLQQDSQEFCQFLLDGLH
EDLNQCGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTDFSVIVDQFQGQYASQLR
CKVCGGTSTTYQAFSVLSVPVPRGKSCNIIDCFNEFTKVENLETDELWACPHCKKKQPST
KKLTITRLPRNLIIHLKRFDNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGVTEELPT
RGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPLKNSYECITSNAY
VLFYHRVYGV
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacactaactcagaaaaagtgttacactttgatcccattgttagattgtcagaa
attgctgataagtttatttcacaagataataaatatactaatatgaaatcctccttacag
gaatgtattgacacattagcaaactatcaagatgaatgtaagaaattaaagaaattaagt
gttaaaaatcagcaagatgattctgacaaaaaagacatcaacttattaggtgacatttat
tcattatatgaatcagcatatatttactataagataatacatataattgtgttaaacaga
atacctaatttacaagaatttgctcactccaaaagtcaaaatgcaacaaaagaagaagaa
gaactattgaaaatttataacatgctagtgaagaccttattaaatgatgacaaaatacag
catatcaagacatatttaagaaacaatcaagtcacaaagaatcacaaaacaactgaggag
tataagaaagatattaacaaggaattaataaatactgaattatttaatttaccattatcg
ggatcaggaatctctgctattcagttaaatcatttaattcaaatatataatgacacacta
ttagtcatcgatgtacgaccaagaatggaatttgaagaatctcatattaaatgtaaaaat
attatatgcattgaacctgtatcattcaatgaatcttttacagacttagaattacaaaaa
aaatcaatgattacttcacctagtgatgaggttaaaacttttgctaaaaaagataccttc
aattatatcgtaatatgtacagacactgatgagaaaaaacaattttatctacaccaacag
ttagtgttattagatttattaatgaacaaatcattcactaaaccaatgtttcaaaaaaat
gtaaaaatattcattttagagaaagggtttaaaaattgggtctacaaaaaaggagaatgt
gaggcatcctcaccgattactgatgtagttaaacctgattttacaactactagaattcaa
gataataataaattaattgagaaaccagagatacagaagcaaagtggggatagtatatat
attgaaggaaacacttcagctcttaatctacaaaaattgcctgaattgaccgctaatgtg
ggctatgccaaggataattcgatgagagtgatgatgaattcttccagtaatttcagctac
tctaaagattatcatttaccgttacagcaatccccgttaccgcaaaggacaccgagtttt
aagagcctattcaatagaaatggttctattccaacagtttcccaaaatggaaatcctgca
gcttcaccatatatgacaaagtattcaaattcaggtcaatataatataaactctgaaagc
cctcacaagtccccgtccacatctcaaattaccaatgcgtattccttacctgtcaattca
aaaccatcgataaatttgaatatatcacgatatccagaaactccaaacttatcaactgtt
tctactaataatatgaatattcataataataccatgggccctatttctcctatcaatagt
agagtaataaccccgtcatcgagactcgatgaatcatcgtctcctggtcatagacttgtt
cccatcaacagttcagaattgtataatataaaaagcattgaaaattacaaaccaagtagc
ggatctacaatgaaacccttattattaaaatcggctacgtcaaaaccaccaagtcaatcg
ttaccttcattgcctcagttaccttcagcatcagacacattgaaatcatatactaattct
gacaaggattacgatttttctataggtttggaaaacatgggtaattcatgttatctaaat
tgtatcattcaatgtttattaagttctcatgaatttacaagaatatttttaaataattca
tatgagaaacatatcaatttaaagagtaaattaggctcgaagggggtattggcaaggaat
tttgcgagactaataaatacaatgtatactgaagggtctgaacagagtaagaatgacaga
aatggtccagtaaaacctgctcagtttaaattggcttgtgggtctataaattcaattttt
agaagtgatttgcaacaagacagtcaagaattttgtcaattcttactagatggattgcac
gaagatttaaaccaatgtggtgcaaaccctccattgaaggaactttcaccgaacgctgaa
aagatgagagaaaaattgtctctgagaattgcttcatctattgaatgggagagatatcta
actaccgattttagcgtaatagttgatcaatttcaaggacaatatgcctcgcaactaaga
tgtaaggtttgtggaggaacttcgactacgtatcaggcattttcggtattatccgtacca
gttccacgtggtaaatcgtgtaacataattgattgttttaacgaatttaccaaggtagag
aatttagaaacagatgaattatgggcatgtcctcattgtaaaaagaagcaaccatccact
aaaaaattaacgatcacaaggctgccaagaaatttaattattcatctcaagaggttcgat
aacatgttaaataagaataatatttttgttaaatatccatttttattggatctaacgccc
tattgggcgaatgattttgatggcaggctgccgccgggtgtaacagaggaattgccaacc
agaggccaaataccaccattcaattataagttaaatgcagttgcagcacattttggaagt
ttatatggtgggcattatacatcttatgttgataaaggtaagtttggatggcgttatttt
gatgatactaaaatcagacctttgaagaattcatatgaatgcataacttctaatgcgtac
gttttattctatcacagagtgtatggagtttag

DBGET integrated database retrieval system