KEGG   Tetrapisispora phaffii: TPHA_0C02880Help
Entry
TPHA_0C02880      CDS       T02235                                 

Gene name
TPHA0C02880
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TPHA_0C02880 (TPHA0C02880)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TPHA_0C02880 (TPHA0C02880)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TPHA_0C02880 (TPHA0C02880)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:623723..624778
Genome map
AA seq 351 aa AA seqDB search
MGKKIVFNISSEFQLKSLLGEGAYGIVCSATHKPTGETVAIKKIEPFDKPLFALRTLREI
KLLKHFQHENIISLFDLQKPDSFENFNEVYIIQELMQTDLHRVISTQQLSDDHLQYFIYQ
TLRAVKILHSCNVIHRDLKPSNLLINSNCDLKVCDLGLARIGKDNDSDGDEQDTSAMTEY
VATRWYRAPEVMLTAAKYTKAMDIWSCGCILAELFLKRPIFPGKDYRHQLMLIFGFVGTP
DEEGLQCIESQRARQYIASLPSYDPVNVEEVFKGVNPLGIDLLQKMLVFDPAKRITAEEA
LNHPYLDVYHDPNDEPDGEPIPLNFFEFDKYKSTLTTKDLKNLLWQEIFSS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaaatagtcttcaatatatcaagtgaatttcaattaaaatcgcttttagga
gaaggtgcgtatggcattgtatgttctgccacccataaacccactggtgaaacagtggca
ataaagaagattgagccatttgataagccattatttgcattaagaacattaagagaaatc
aaattgttgaaacacttccagcatgaaaatattatatcgctttttgatcttcaaaaacct
gattcattcgagaactttaatgaggtttacatcattcaagaactcatgcaaactgaccta
catcgtgttatctctacacaacaactatccgatgaccatttacaatactttatatatcaa
actttaagagcagtaaaaattttgcatagttgtaatgtaattcacagggatttgaaacct
tctaatttattaataaattctaattgtgatttgaaagtatgtgatttaggattagctaga
ataggaaaggacaacgattcggatggtgatgaacaagataccagtgcgatgactgaatat
gtagccacgagatggtacagagcacctgaagtcatgttaacggcagctaaatacaccaaa
gccatggacatatggtcatgtggatgtatcttagctgaattatttctaaagagaccaatt
tttcccggtaaagattacaggcatcaacttatgttaatatttggatttgtcggaacaccc
gatgaagaaggtttacaatgcatagagagtcaaagagcaaggcagtacatcgcatcatta
ccatcttacgatccagtgaacgttgaagaagttttcaaaggagtgaacccattaggtatt
gatttattacaaaaaatgttagtattcgacccagccaagagaataacagctgaagaagca
ttaaatcatccatatctagatgtctaccatgatcctaacgatgaaccggatggtgaacct
ataccccttaacttctttgaattcgacaagtataaaagtacgttaactacaaaggatctt
aaaaacttattatggcaagaaattttctcttcttaa

DBGET integrated database retrieval system