KEGG   Tetrapisispora phaffii: TPHA_0C03390Help
Entry
TPHA_0C03390      CDS       T02235                                 

Gene name
TPHA0C03390
Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(743315..745420)
Genome map
AA seq 701 aa AA seqDB search
MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR
MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE
ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC
KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD
IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG
VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL
ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS
KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLP
KNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET
AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL
GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK
KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacagattggggataaacgaaaactgaaggatgagagtgaatttccttctgtt
tctattggtgacgaagggaaagtcattcaagttttacctaagagaccggtgatagttcca
actcagaaacctaacttacactatactccattgaaaaccggtatttgctacgatgtcagg
atgagataccatgcaaaaatattcacatcatattttgagtacattgacccacatccagaa
gatccaagaagaatatatcgtatttataaaattttagcagaaaatggtttaattaatgat
ccttctttgacaggtgtttcagatattggtgatttaatgttaaagattccagtgagggaa
gcaacaaaagaagaaattcttgacgttcatacagaggaacatatgcagtttttagagagt
actgaaaaaatgactcgtgaagaattattgagcaaaacagaaaaaggtgattccgtttat
ttaaataatgattcttatataagtgcaagactgtcatgtggtggtgctatagaagcctgt
aaagctgtcgttgaaggtagagttaaaaatgcacttgctattgtaagaccacctggtcat
catgctgaaccgcaagctgctggtggtttctgtttgtttagtaatgtcagtgtagctgca
aaatcgattctgaaaacatatccagaaagtgtaagaaaaattttgattgtagattgggat
atccaccatggtaatggtactcaaaaggcattctatgaagacgacaatgttctttatatt
tcattacataggtttgaattaggaaaattttatccaggctttccagaaggtaattacgat
aaagttggggacggtaaaggtaaaggtttcaattgcaacatcacatggcctgtaaaaggt
gtaggtgatgtagaatatatttgggcttttgagcaaatcgtaatacctatggcacgtgaa
tttagaccagatttagttattgtatcgtcagggtttgatgctgcacacggcgatactatt
ggacaatgtcacgttacaccaaactgttatggttatatgacacatatgttaaaatcatta
gctagaggtaatttatgtgttgtacttgagggtggttataatctggactcaatctctaat
agtgccctagcagttgcaaagatacttataggtgaaccaccggacgaaatacctgaatcc
gatagagaccctaaacctggagtccttgaaatgataaataaagtcattagggtgcaatca
aaatactggaagtgtttcagacgcaaatttggtaattttggaggggagtacgaaaatgcg
attgaatctcaaataccgaaaatgttcccactacaagatgccattagaaatgcacaacta
tctcattattatgatgattttggtatgattagtttaagcttaccaaatttgaatttacca
aaaaattcaataatatgttcaagtaattttttcaaggcaaaatcattatgcgtcttattg
catgacacgcctgaagtgtggggaaatagagacataataactggtattatcgatccttct
acttcaataatatttgattcctcgttgaaatttataaactgggcaattgagagagaaacg
gctgttatcgatattaatattcctagatccgcatttgaagctgataattattcatcaaat
ttactatctcaggatgttatgatctcactttgggataatcatttcaagtacattgaatct
ctagagaaattgtgctttattggtattggagaggcaacatctgggattgtgcatttatta
ggtaaaagagatacaaggacagttacaaaagcagcaataaattttgtaggaagtagttct
ttgaaaccgatagtcccatcattagatgaatctctaggtgattggtacttcaagaactca
ttggttttcacagatcatttccacggttgttggtctgagaatgacaaaaaaccgcgtaag
aaatatggtagagttctcagatgtgatactgacggaatacataatataatagaagaaaga
tttgaagaggcaacagactttatcttagatgcatttgatgaatggagtgatacggaagac
gaataa

DBGET integrated database retrieval system