KEGG   Tetrapisispora phaffii: TPHA_0C03750Help
Entry
TPHA_0C03750      CDS       T02235                                 

Gene name
TPHA0C03750
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tpf  Tetrapisispora phaffii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:tpf00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:814891..817290
Genome map
AA seq 799 aa AA seqDB search
MAKKPGKTQNSQAQSQRASKKNKIPADEPSPSLLQAIDQDPVLPFEVKDGPERPFLQIDT
EIDEQTDKSAPDRKEKIVQLRTMNTKVERLLVLSLVLIASYVRLKNLSWPNSVVFDEVHF
GKFAAKYVKNQFFFDVHPPLAKMLFAYFSSMAGFKGDFLFSKIGEEFPSDTPYVFMRLFA
AVSGLFTVLLMYFTLRSSGIRMWVAYLVTLCFAVENSFVTISRYILLDSPLMLFIAAAAY
AFKKSQLYPALSFNGSRYLLATGVALGFAVASKWVGLFTIAWVGALCAIRLMFYLGDLTI
PISKTIKIALSKLIFLLVVPFILYATFFYVHFETLINDGDGSAFFSPGFRMTLKGNNIPQ
NVYSDVGVGSVVTLRHLGTHGGYLHSHTATYETGSKQQQVTCYGHLDDNNKWLIELANRP
GVTLNSFQNITDGEKIKLFHINTQHRLHSHDHKPPVSSNSDWQKEISCYGFAGFNGDWND
DWTVEIDKRKSTPGDAQKVVKAIDTKFRLRHSSGCYLFSHKTKLPKWGFEQQEVTCAHSG
KPHLTLWQIEGSESAVLPSDSKRTSYSIPNFWSKFIESHKVMWNINKGLTATHVYQSYPQ
EWPLLQRGISYWGNHNRQVYLFGNAILWWSVSFAVVLFAIVSAVELILWHLGSPVLNEPH
VMNYHIQYVEYILGFLAHYIPSFLMQRQMFLHHYLPAYYFGILAFAHAFDITVTYVCKKK
RVGQVLALIFTIVVVAFYYYYSPIIYGTEWTKEQCKKTQWFHGWDYNCNGFVDDLTEYAT
IPTTTTTTAAETAAAAAAN
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacctggtaagacccagaactcgcaagctcaatcgcaaagggcaagtaaa
aaaaataaaatcccagcagacgaaccaagcccttcattgttgcaagccattgatcaagat
cctgtgttaccattcgaagttaaagatggtccagaaagaccttttttacaaatagacaca
gagatcgatgagcaaacagacaaatcagccccagatcgcaaagaaaagattgttcaatta
cgtacgatgaatacgaaagtagaacgtttgttggttctctctttagtactcattgcttca
tatgttagattaaagaacttatcctggccaaactcagtggtcttcgatgaagttcatttc
ggtaaatttgctgctaaatacgtgaagaatcaattcttctttgatgttcatcctccatta
gctaaaatgttattcgcatatttctcttcaatggcaggttttaaaggtgatttcttattt
tcaaagattggtgaagaattcccatcagatactccatacgttttcatgagacttttcgct
gctgtatcgggtctatttacagtattgttaatgtattttacattaagatcttccggtatt
agaatgtgggtagcctatttagttactctttgttttgccgtcgaaaattcttttgtcacc
atctctcgttatatcttattggattctccattaatgttattcattgcagcagcagcttat
gcattcaaaaaatcacaattgtacccagcattaagtttcaatggctctagatatctatta
gccactggtgtcgccttaggtttcgccgttgcatcaaaatgggtaggtctttttacaatt
gcttgggtcggtgctttgtgtgctattaggttaatgttctacttgggtgatttaacaatt
ccaatctcaaagactattaaaatcgctctctctaaattgatcttcttattggtggttcca
tttattttatacgctacttttttctatgtacattttgaaacgctaattaacgacggtgat
ggttccgcattcttttctccaggttttagaatgactttaaaaggtaataatatcccacaa
aatgtttattccgatgttggtgtcggttcagttgtcactctaagacatttaggtactcat
ggtggttatttacattcgcataccgcaacttatgaaactggttcaaagcaacaacaagtt
acttgttatggtcatttggatgataataataaatggttaatcgaattagcaaacagacca
ggtgtcacattaaactcattccaaaatatcacagatggtgaaaagattaaattattccac
attaatactcaacatagattacactctcacgatcataaaccaccagtatcatcaaatagt
gattggcaaaaggaaatttcttgttacggttttgctggtttcaatggtgattggaatgat
gactggaccgttgaaattgataagagaaaaagtactccaggtgatgcccaaaaagttgtc
aaagcaattgatactaaatttaggctaagacacagttcaggttgttatttattctctcat
aagactaaattaccaaaatgggggttcgaacaacaagaagtcacatgtgctcattcaggt
aagccacatctaactctatggcaaatcgaaggcagtgaaagtgctgttctgccatcggac
tccaagcgtacctcttactctattccaaatttctggagtaaattcatagagtctcacaaa
gttatgtggaacattaacaagggactaactgctactcacgtctaccaatcttatccacaa
gaatggcctctattacaacgtggtattagttactggggtaaccataacagacaagtttac
ttattcggtaacgctatcttatggtggtctgtctcttttgccgtagttctgtttgcaatt
gtttcggctgttgaattgatactatggcatctaggatctcctgtcttaaatgagccacat
gtcatgaactaccacatccaatacgttgaatatattttaggtttcctggcacattatata
ccatctttcttgatgcaacgtcaaatgtttttacatcattatttaccagcatattatttc
ggtattttagccttcgctcatgctttcgatattaccgttacttatgtctgtaagaaaaag
agagttggtcaagttttagctctaatttttactatcgttgtcgtcgcattttactattac
tattctccaatcatttacggtacggaatggactaaagaacaatgtaaaaagactcaatgg
ttccacggttgggactataactgcaatggttttgttgatgatttaacagaatacgctact
attccaactactaccactaccactgctgctgaaactgctgctgccgctgctgctaactag

DBGET integrated database retrieval system