KEGG   Tetrapisispora phaffii: TPHA_0C03980Help
Entry
TPHA_0C03980      CDS       T02235                                 

Gene name
TPHA0C03980
Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tpf  Tetrapisispora phaffii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TPHA_0C03980 (TPHA0C03980)
Enzymes [BR:tpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TPHA_0C03980 (TPHA0C03980)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TPHA_0C03980 (TPHA0C03980)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(855236..856279)
Genome map
AA seq 347 aa AA seqDB search
MPHTAEYINFEGTSNNVEITSILSGGYNHPLLREWQNERQLTTNMLIFPIFLSDIEDDET
AIDSLPNIKRFGVNKIVAYLKPLVEKGLRSVILFGVPLKEGAKDAYGTNADDPNGPVIQG
IKILKKNFPNLYIICDVCLCEYTSHGHCGILDDSGAIDLNPSVSRIAAVAINYAKAGAHC
VAPSDMIDGRIQMIKKGLLSNGLANKTFVLSYSAKFSGNLYGPFRDAACSSPSSGDRKCY
QLPSGGRGLARRALKRDLQEGADGIIVKPSTFYLDIMRDAAEICHDLPVCAYHVSGEFAM
LHAAAEKNVVDLKTIVLESHQGFLRAGARLIITYFAPELLDWLKESQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccacatacagccgaatatattaattttgaaggtacatctaataacgtcgagatcaca
tcgattttatctggtggttacaaccatccgttattgagagaatggcaaaatgaaagacaa
ttgactaccaatatgttgatttttccaatttttttatcagacattgaagatgatgaaact
gctattgattctttacctaatatcaagagatttggagttaacaaaatagtggcttatttg
aaaccattggtcgagaaaggattaagaagtgttatattgtttggcgttccattgaaagaa
ggtgccaaagatgcatacggtacaaatgctgatgatccaaatggcccagttattcaaggt
attaaaattttgaaaaaaaatttccctaatttatacattatttgtgatgtctgtttatgt
gaatatacatctcatggacattgtgggattttagatgactctggtgccattgacctaaac
ccaagtgtttccagaatagctgcagtagccataaattatgccaaagcaggtgcccattgt
gttgctccatctgatatgattgatggtagaatccagatgatcaagaaaggtttattaagc
aatggcttagccaataaaacttttgttctatcatactctgccaaattcagtggtaactta
tacggaccattcagagatgccgcatgttcgtcaccttcaagtggtgaccgtaaatgttac
caattgccatctggaggtagaggcctagcaagaagagcattgaagagagatctacaagaa
ggtgccgatggtattattgtaaaaccttcaactttctatttggatatcatgagagatgct
gctgaaatttgtcacgacctaccagtctgtgcgtaccatgtaagtggtgaatttgcgatg
ttacatgctgctgctgagaaaaacgttgttgatttgaagactattgtattagaatctcat
caaggtttcttgagagctggtgcaagattaatcatcacatacttcgcacctgaactatta
gattggctcaaagaatctcaataa

DBGET integrated database retrieval system