KEGG   Tetrapisispora phaffii: TPHA_0C04030Help
Entry
TPHA_0C04030      CDS       T02235                                 

Gene name
TPHA0C04030
Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
tpf  Tetrapisispora phaffii
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:864403..865677
Genome map
AA seq 424 aa AA seqDB search
MSDDKGTNHHDNGDNMSLKPVVKTRSRRTSSVGNINLGDTISSISTMKLTKEQKLASKER
LKELNRNIDNNDKDLARKIWLSYLEINYRRVWLTPLLILLIVYFAYYTSGNKTESNPLYQ
FINISYQVGDTDQYGKGIKDLSFVAFHMVFFTFLREFLMDAIIKPITINKLKITKTHKVK
RIMEQVYSIIYYGTSGPFGIYIMYHSDLWLFKTETMYATYPNFYNSYLYKFFYLGQASFW
AQQACVLVLQLEKPRKDYNELIFHHVVTLLLIWSSYVFHFTRMGLAIYITMDVSDLFLSL
SKLSNYLELGCTPVIFFIFIAVWVYLRHIVNIKILWSVLTEFRTVGSYTLNFATSQYKCW
ISLPIVFTLIAALQLVNLYWLFLIFRILYRLIWLDIQKDERSESSSEDEDTPSSEFHSES
KEDI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgataaaggaactaatcaccatgacaacggtgacaatatgagtttaaaacca
gtcgtcaagactagaagtagaagaacttcatccgttgggaacattaatttgggtgatacg
atttcgagcatatcaactatgaaattgactaaagaacagaagcttgcctctaaggaaaga
ttaaaagaattaaatagaaatatagataataatgacaaagatttggccagaaaaatttgg
ctttcttatttggagattaattacagacgtgtttggttaactcctttacttatattgttg
attgtttattttgcttattatacttcaggtaataagactgagtctaacccattgtatcaa
ttcattaacatttcgtatcaagttggtgatacagatcaatatggtaaaggtatcaaggat
ttatcattcgttgcgttccatatggttttctttactttcttaagagaattcctaatggat
gctataatcaaaccaattactatcaataaattaaagattacaaagactcataaagttaag
agaattatggaacaagtatattctatcatttattatggtacttcaggtccatttggaatt
tacatcatgtaccattcagacttatggttatttaaaactgaaacaatgtacgcaacttat
ccaaatttctataattcatacttatacaaattcttttatttgggtcaagcttcattttgg
gctcaacaagcgtgtgttctagttttacaattagaaaaaccaagaaaggattacaatgaa
ttgattttccatcatgtcgtcactttgctattaatttggtcatcttatgtgttccatttc
acaagaatgggtttagcaatttatatcacaatggatgtctcagatttgtttttatcacta
tcaaaattatctaattatttggagttaggatgcaccccagttatcttttttatattcatc
gctgtttgggtatatttacgccatattgtgaacatcaaaattttatggtcagttttaaca
gaattccgtactgttggatcatatacgttgaatttcgctacttcacagtataaatgttgg
atttctttaccaattgtatttacgttgattgctgctttacagttagtaaacttatattgg
ctatttttgatcttcagaattttatacagattaatctggttagatattcaaaaagatgaa
agaagtgaatcatcatcggaagatgaagacactccttccagtgaattccattcagaatca
aaagaggacatttaa

DBGET integrated database retrieval system