KEGG   Tetrapisispora phaffii: TPHA_0C04270Help
Entry
TPHA_0C04270      CDS       T02235                                 

Gene name
TPHA0C04270
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tpf  Tetrapisispora phaffii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tpf00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpf00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tpf00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tpf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(920351..921853)
Genome map
AA seq 500 aa AA seqDB search
MSTGKRHTKTQSSYAFESSTSNVAASQMRNALNKLDDTMPNDNAASARFQNELDSFFTLF
RRYLIEKNSKNKLDWEKIKSPNPEEVVEYKIIEQQPENVSNLSKLAVMKLNGGLGTSMGC
VGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSSNRI
RIKSFNQSRFPRVFKDSLLPVPNDVNDSLDSWYPPGHGDLFESLYASGELDALIDQGKEI
LFVSNGDNLGATVDLKILNHMIETNAEYIMELTDKTRADVKGGTLISYDDQVRLLEVAQV
PKEHIDDFKNIRKFKNFNTNNLWINIKAIKRLVEQNALELEIIPNEKTISRNGHDVNVIQ
LETACGAAIRYFNGAHGVVVPRSRFLPVKTCSDLLMVKSDLFYLEHGALKIDPSRFGPNP
LIKLGSHFKKVNDFNQRISHIPRLLELDHLTITGNVYLGKNVSLKGTVIIVCSDGQKIDI
PNGSILENVVITGNLQILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtccactggtaagagacacaccaagactcaatcgagttacgctttcgaaagtagcact
tctaatgttgctgcttctcaaatgagaaatgctttgaacaagttagatgatactatgcct
aacgataatgctgctagtgctagatttcaaaatgaattggattctttcttcactttattt
agaagatatttaattgaaaaaaactcaaagaataaactggattgggagaagattaaatct
ccaaacccagaagaagttgtcgaatacaagatcatcgagcaacaaccagaaaatgtctct
aatttgtcaaaattggctgtcatgaagttgaatggtggtttaggtacctccatgggttgt
gttggtccaaaatcagttattgaagttagagatggcaacactttcttggatttatccgtc
agacaaattgaatatctaaatagacaatacgacagcgatgttccactactattgatgaat
tctttcaacactgataaggatactgaacatttgattaagaaatattcttctaatagaatt
agaattaaatcttttaatcaatcgagattcccaagagtcttcaaggattctttactacct
gtaccaaacgatgtcaatgactctttggactcttggtatcctccaggccatggtgattta
tttgaatcattatatgccagtggtgaattagatgctttaatcgatcaaggtaaggaaatc
ttatttgtctccaatggtgataatttaggtgctactgttgatttgaaaatattaaatcat
atgattgaaacaaatgcagaatatattatggaattaactgataagacaagagccgatgtt
aaaggtggtactttaatctcctatgatgaccaagttaggttattagaagtcgctcaagtt
ccaaaagaacatatcgatgatttcaagaatattagaaaattcaaaaattttaacacaaat
aatttatggataaacattaaggctattaagagattagtcgaacaaaacgcactagaattg
gaaatcattccaaatgagaagacaatctcaagaaatggccatgatgttaatgtcattcaa
ttagaaactgcctgtggtgctgccattagatacttcaatggtgctcacggtgtcgttgtc
ccaagatcaagattcttgcctgttaagacttgttccgatttattaatggtaaagtcagat
ttattctacttagaacacggtgctctaaagattgatccatcaagatttggtccaaatcca
ttaattaaattaggttctcattttaaaaaagttaatgacttcaaccaaagaatttcacac
attccaagattattagagctagatcatctaacaatcactggtaacgtctacttgggcaag
aatgtttcattaaagggtaccgtcatcattgtctgttcagatggacaaaaaattgacatt
ccaaatggttccatcttggagaatgtcgttattacaggtaatttacaaatcttagaacat
tga

DBGET integrated database retrieval system