KEGG   Tetrapisispora phaffii: TPHA_0C04340Help
Entry
TPHA_0C04340      CDS       T02235                                 

Gene name
TPHA0C04340
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tpf  Tetrapisispora phaffii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TPHA_0C04340 (TPHA0C04340)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TPHA_0C04340 (TPHA0C04340)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:936055..937671
Genome map
AA seq 538 aa AA seqDB search
MALANFTKLKSNSSIAVVGSGVSGLTFTYFLNKLRPDLKITILDEQKKNGGWLYSYKFQD
SNDNNKDVMLEKGPRTLRGKSLGTAIIIDIIKKLEQFEKVQTISPLSDANKKFLLDVNNN
LVKVPNKILSFDSINLLFFNSLGKNIFTSIIGEPFRSKKILSKNDDETVSSFLNRRFGKS
NSVSNNLMSAIYHGIYADDLNRMSLKKQIQHCSMLERTYGSIIKSLFSSDSSSNAVQEQT
ELTRYDQHFNNKNSEIFKLNKQLEKFPMLGITGGLQSFPNMISNYLVNKCLPNVKIIREA
RVDNIEDSKDKVILNFDDEKNKPMEFDHVRVTSNPMKLKSFFKGSKEIEEKLRNYNSVTT
LLVNYYLPNKDVIKSRYHSFGYLVPQANENKNSLLGVIFDSVIEKNFQSLEKGKNIVPNE
YTKLTLMMGGHYLEKKNYTETQINDSQYWISNAKDCLSKHLGIDKQDLDNGHFEFTVAKN
GIPQYFVGYMEWANDFEKLISDTYNNKVSLGGMGFSRGPGVPDVVVDSLDNAIKLSGK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcattagctaattttactaaattgaaatctaacagctccatagctgtcgttggaagt
ggtgtttcaggtttgacatttacttattttttgaacaaattgagaccagatttgaaaatt
accattcttgatgagcaaaagaaaaatggtggttggttatactcttacaaatttcaagat
tcgaatgataataataaagatgtcatgttggagaaaggaccaagaacattaagaggtaaa
tctcttggtactgctattataattgatattattaaaaaattagaacaatttgaaaaagta
caaactatctcacctctatcagatgccaacaagaaatttttattagacgttaataacaac
ttagttaaagttccaaataaaattttaagtttcgatagtattaatttattattctttaat
tcattaggtaaaaatatcttcaccagtattattggggaaccatttagaagcaaaaaaata
ttatcaaagaatgatgatgagactgtttctagttttctaaacagacgatttggtaaatct
aattcagtgagtaataatttgatgagtgcaatttatcatggtatttatgcagacgactta
aatagaatgtcattaaaaaaacaaatccagcattgttcaatgttagaaagaacgtatgga
tcaattattaaatcattgttttcaagtgattccagctcaaatgctgtgcaagaacaaact
gaattgactagatatgatcaacattttaataacaaaaatagtgagatttttaaattaaat
aaacaattagaaaagtttccaatgttaggaataactggtggtttgcaaagctttccgaac
atgatttctaattatttggttaataaatgtttaccgaacgttaagattattcgtgaagct
cgtgttgataatatagaggattcaaaggataaagtgattttgaattttgatgacgaaaaa
aataaacctatggaatttgatcatgttagagtcactagtaatccaatgaaattgaaaagc
tttttcaaaggatcaaaagaaattgaagaaaaattgagaaattacaattctgttacaaca
ttattagtgaattattacttaccaaataaggatgtcataaaatcaagatatcatagtttc
ggttatttagttccacaagctaatgagaacaaaaatagtttattaggtgttatttttgat
tcagttattgaaaaaaactttcaatcgttagaaaaaggcaaaaacattgttccaaatgaa
tatacaaaattgacattgatgatgggaggacattatttagagaaaaaaaattataccgaa
actcaaatcaatgatagtcaatattggatttcaaatgctaaagattgtttgagtaaacat
ttaggaattgataaacaagatttggataatggtcattttgaattcacagttgctaaaaat
ggtattcctcagtattttgttgggtacatggaatgggccaatgattttgagaagttaata
agtgatacttataacaataaggtctcattgggtggtatgggattctcaaggggaccaggc
gttccagatgtcgttgttgacagtctagataatgctattaagttgagtggtaaataa

DBGET integrated database retrieval system