KEGG   Tetrapisispora phaffii: TPHA_0D02550Help
Entry
TPHA_0D02550      CDS       T02235                                 

Gene name
TPHA0D02550
Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
tpf  Tetrapisispora phaffii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TPHA_0D02550 (TPHA0D02550)
Enzymes [BR:tpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TPHA_0D02550 (TPHA0D02550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:523687..525456
Genome map
AA seq 589 aa AA seqDB search
MNELTSDIDTDSIFSSVSKDMTPEEVVVDKTEERINKKGIKKLSSVQSLLNDAYKYSSHT
EYTLPESFLRTRNKPKIIEDVEYEAPRPKKKIQIKTQRKKLKVEKPVKPKKIKKVKAKLE
GKTIKSNGEVQISYRGRKKGSKNKKTITKLEKDNKLNENTLQNERIKETQINQQETNQKE
PTDFIDLSLEPFPLKYDFFDIDYLKSNTELNELPNPSTSLTNKYYSPTASQMNSEGSQVY
KIVKLRYPLFTNYSEEFHVDFLNKHFDTIYNPMVELGKLIEYFAKVYIPDAYYNEISREI
IKPMNHAFDIKDVEKFTDAINKYNTFILTIPRDEIIKKLECTKELPKYFIQDLLHVVYTR
SIHPKAKTLKKYAAFSSYVYGELLPSFLSEIYSNCSLSSDKIFMDLGSGVGNCVVQAALE
YGCKLSFGCEIMENASDLTEAQYSELTKRCKLFGIKLSPIKYSLRKSFIDNDEVSKLIKE
CDVLLINNFLFDAKINNAVTKILQSCKPGCKLISLKSLRPVSYTIDFNDTENILNRMKIT
KHNLKENSVSWTHSGGEYYISEVMTELDESLFTLNAGHRKTHKVIKYTR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattgacttctgatatagatacagattctatattttcaagtgtgtccaaggat
atgacaccagaagaagttgtggttgataaaacagaggagagaattaataaaaagggcatc
aagaaattaagctcagtccaatctttgctaaacgatgcgtacaaatactcttctcatact
gaatatactttaccagagtctttcctaagaacaaggaataagcctaaaattatagaagat
gtagaatatgaagctccaagaccaaagaaaaaaattcagattaaaacccaaaggaaaaaa
ttgaaagtggagaaacctgtaaaacctaaaaagataaaaaaggtcaaggccaaattagaa
ggaaaaacaataaagagtaatggagaagttcagatatcatatagaggaagaaagaaggga
agcaaaaataagaagactattactaagcttgaaaaggataataaactcaatgaaaatact
ttacaaaatgaaagaataaaagaaactcaaatcaatcaacaagaaactaatcaaaaagaa
ccaacagatttcattgacttatctttagaaccgtttcctctgaagtatgatttctttgat
atcgattatttgaaaagtaatacagaattgaatgagctacctaatccatcaacatcttta
acaaataaatattattctccaactgcatctcaaatgaattctgagggttcacaagtttac
aaaattgttaaactacgatacccactattcaccaattactctgaagaatttcacgttgat
tttttgaataaacattttgataccatttacaatcctatggtggaactaggtaaattgatt
gaatattttgccaaagtttacatcccagatgcatattacaatgaaatatcgagagaaatc
attaaacctatgaatcacgcattcgatataaaggatgttgaaaagtttaccgatgctatc
aataagtataatacctttatcctaactattcctagagatgaaataattaaaaaactcgaa
tgtacaaaggaacttccaaaatattttattcaagatcttctacatgttgtttatacgaga
agtattcatcctaaagctaaaactttaaagaaatatgctgcatttagtagctatgtttat
ggtgaattgcttcctagttttctatcagaaatttattccaactgctctttaagttctgat
aaaatatttatggatcttggatctggtgtaggtaattgtgtcgttcaagcagcattggaa
tacggttgtaaattgagctttggttgtgaaataatggaaaatgctagtgacttaactgaa
gctcagtattcagaattgacgaaacgatgtaaactttttggtatcaaactaagtcctatc
aaatattctctcagaaaaagttttatcgataacgatgaagtttcaaaacttataaaggag
tgtgacgttctattgataaataattttttattcgatgcaaagattaataatgcagttaca
aagattcttcaaagttgtaaacccggttgtaaattaatttctttaaaaagtttaagacct
gtttcgtatacaattgattttaatgatacggaaaatatattgaatagaatgaaaattaca
aagcataacttaaaggaaaatagtgtttcatggacacatagtggaggtgaatattacata
tcagaagtaatgacagaattagatgaatctctttttactttaaacgctggacacagaaaa
actcataaagttatcaaatatactagataa

DBGET integrated database retrieval system