KEGG   Tetrapisispora phaffii: TPHA_0D03380Help
Entry
TPHA_0D03380      CDS       T02235                                 

Gene name
TPHA0D03380
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
tpf  Tetrapisispora phaffii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TPHA_0D03380 (TPHA0D03380)
Exosome [BR:tpf04147]
 Exosomal proteins
  Proteins found in most exosomes
   TPHA_0D03380 (TPHA0D03380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:709300..714243
Genome map
AA seq 1647 aa AA seqDB search
MSDLPIEFTELVDLTSLGISPQSLEFRSTTFESDHYVTVRESQDGNNSVAIVDLSNGNLV
TRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLKTKSKLKSFTLDEPVLFWKWLNEETLG
FITARSILTSNVFDGNVNAAPTVLTQRHQTLNNTQIINIVSNKKMDWFAVVGILQDNGHI
AGKIQLFSKQRNISQAIDGHVAMFSDITLEGNSTPVQVFVTGNRNASSGTGELRIIEIDH
DANLPVQYQKKNVEVFFPPDATNDFPISVQVSEKYGIIYLLTKYGFIHLYELETGTNLFV
NRITAESVFTATSYDNKNGIACINKKGQVLAVEISTSQIVPYVINKLSNVSLALTMAKRG
GLPGADDLIQKQFDTLLAQSDYQGAAKVAASSQQLRNSNTINRLKTAQAEPGAISPLLLY
FSILLDTSKLNKEETIELARPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDTTLALA
CYLRAECHPKVVASLAELQQFEKILPYCQKVNYQANFLVLLSTVMRSSPDRASEFATSLI
QNPETAAQLDIEKIADMFFSQNHIQQGTSLLLDALKSDTPDQGHLQTRVLEVNLLHAPQV
ADAILGNNIFSHYDKPVIASLAEKAGLYQRALENYVDIRDIKRCIIHTNVLPVDWLVSYF
GKLNVEQSMACLKALMDNDIKQNIQIVVQVATKYSELIGSTILIKLFEEYGATEGLYYYL
ASSVNLTEDKDLVYKYIEAAAKTKQYTEIERVVKDNNVYDPERVKNFLKDINLEDQLPLI
TVCDRFNFVNELVIYLYNQQNTKFIETYVQQVNPTKTPQVVGALLDVDCDENFIKSLLQS
VFGQVPIKELTEEVEKRNRLKLLLPYLEQCLTQGIQEQVIYNALAKIYIDSNNGPEKFLK
ENDQYDTLDVGRYCEKRDPFLAYIAYDKGNNDQDLIRITNDNSMYKYQARYLLKRSDSEL
WNSVLSSENVHRQQLIEAVNSVGIPELTDPQPVSVAVQAFMQNDLKLELIELLEKIVLEE
SAFSDNVALQGLLLLSAIKYEPNKVRRYIEKLENYDADEIASLCIEHDLKEEAFEIYDKH
EMYSKALKVIVEDIISLDRAQEYVEKINSKELWSQLGASQLAGLRVPEAIESYIKAEDSS
NFEAVIDTAAEAGNYEQLIPYLIMARKTLKESKIDGSLILAYAALDKINEVENIVSNSNA
ANLESVGDKLLASKSYKAAKLCFASISNYSKLASTLVFLGDYQNAVDTARKASNIKVWKQ
VNDVCIDKKEFRLAQICGLNLIIHAEELNELVHKYESNGYFEELISLFEAGLGLESAHMG
MFTELAILYSKYEPAKTFENLKLVWSRINIPKVIRAVEEAHLWNEAVFLYAHYDEWDNAT
LTMIEKSTKSFDHDYFKEIVVKVSNLEIYYKAINFYVKEHPMLLIDLLTVLTPRLDIPRT
VKIFTKSDNLPLIKPFLINVLPKNNSVVSEAYHDLMIEEEDYKALTIAVDSYDKFDQLGL
ASRLEQHDLIFFKKIAALLYRRNKKWAKSLTIFKQEKLWKDAIETAAISQDQKVVEDLLN
YFVEIDNKEALVALLYTAYSLVKFDFVLELAWINSLENYIKPFEISIKKEQATMIEKLSK
ELKSKGNVSNDDNNSDQPLMLTNGMGY
NT seq 4944 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttacctatcgaattcaccgaattggttgatttaacttcactagggatctct
cctcaatccttagaatttagatcaaccactttcgaaagtgatcactatgttacagttaga
gaatctcaggatggtaacaattctgttgcaattgtcgatttaagtaatggtaacctagtt
actagaaaaaatatgggtggtgattctgcgattatgcacccttcgcaaatggttatatct
gttagagcaaatggtacaattgttcaaatctttaacttaaagacaaaatcaaagttaaaa
tcattcactctagatgaacctgttttattctggaaatggttaaatgaagaaactttaggt
tttattacagcaagatccattttaacttctaatgtttttgatggtaacgttaatgcagct
ccaactgtattgactcaaagacatcaaactttaaacaacactcaaatcattaacattgtc
tctaataagaaaatggattggtttgcagttgttggtatcttacaagataatggccacatt
gccggtaagattcaattattttctaaacaacgtaatatctctcaagcaattgatggtcat
gttgctatgttttcggatatcactttagaaggtaacagtactccagttcaagtctttgtt
actggtaacagaaatgcttctagtggtacaggtgaattaagaattattgaaatcgatcat
gatgcaaacttacctgttcaataccaaaagaagaatgtcgaagttttctttccaccagat
gcaactaatgatttcccaatttctgttcaagtttcagaaaaatatggtatcatttatcta
ttaactaaatatggttttattcatctatatgaattagaaactggtactaatttatttgtt
aacagaatcactgctgaatcagtttttactgctacttcatatgataataagaatggtatt
gcatgtattaacaaaaagggtcaagttctagccgtcgaaatttccacttctcaaattgtt
ccatatgtcataaataaactatctaatgtttctttagctttaactatggctaagagaggt
ggattaccaggtgctgatgatttgattcaaaagcaattcgatactttattagctcaaagt
gattaccaaggcgctgctaaagtagctgcctcctctcaacaattgagaaattcaaatact
atcaacagattaaagactgctcaagctgaaccaggtgctatttcaccactattattgtac
ttttctattttattagacacaagcaaattaaacaaagaagaaactattgaattagcaaga
ccagtactacaacaagacagaaaacaattattcgaaaaatggttgaaagaagataaatta
gaatgttcagaagaattaggtgatattgttaagccttttgacactactttagctttagct
tgttatttaagagctgaatgtcatccaaaggttgttgctagtttagctgaattacaacag
tttgaaaagatcttgccatattgtcaaaaagttaactaccaagctaattttttggtttta
ctgtctaccgtaatgagaagttctccagacagagcctctgaatttgctactagtttaatt
caaaacccagaaactgctgctcaattagacattgaaaagattgctgatatgtttttctct
caaaatcacattcaacaaggtacctctttattattagatgctttaaagagtgacacccct
gatcaaggtcacttacagactcgtgtcttggaagttaacttattacatgcaccacaagtt
gctgacgccattttaggtaataacattttctctcattatgataagccggtcatcgcatct
ttagctgaaaaagctggtttatatcaaagagctctagaaaattatgttgatatcagggac
ataaagagatgtatcatccatacaaatgttttacctgtcgattggttagtctcatatttt
ggtaaattgaatgtcgaacaatctatggcatgtttaaaagctttaatggataatgacatc
aagcaaaacattcaaattgtagttcaagttgcaaccaaatattctgaattaatcggttct
acaattttaatcaaattatttgaagaatatggtgccaccgaaggtttatactattacttg
gcctcttcagtaaacttaacagaagacaaagatttggtttacaaatatattgaagccgct
gctaagacaaagcaatataccgagattgaaagagtcgttaaggacaataacgtttatgac
ccagaaagagttaagaacttcttgaaagatattaacttagaagatcaattgccattaata
actgtctgtgaccgtttcaactttgttaacgagttagttatatacctttacaatcaacaa
aacactaagtttattgaaacttacgtccaacaagttaacccaacaaagaccccacaagtt
gttggtgcattattggatgttgattgtgatgaaaactttatcaagtctttgttacagtct
gtatttggtcaagtcccaatcaaggaattaactgaagaagttgagaagagaaacagatta
aaattattattaccttatttggaacaatgtttaactcaaggcattcaagaacaagttatc
tacaatgctttagccaagatttacattgactcaaacaatggtcctgagaaatttttaaag
gaaaatgatcagtatgacactctagatgttggtcgttattgtgaaaagagagatccattc
ttagcttacattgcttacgataagggtaacaatgatcaagatttaatcagaattactaat
gacaatagtatgtacaaatatcaagctagatatttattaaaacgttctgactctgaatta
tggaattctgtcttatcttctgaaaatgttcacagacaacagttaatagaagccgttaac
tctgttggtattccagaattaactgacccacaaccagtttctgtcgctgtccaagccttc
atgcaaaatgacttgaaattagaattaattgaattattggaaaagattgttttagaagaa
tccgcttttagtgacaatgttgctcttcaaggtctattgttattgtctgctatcaaatac
gaaccaaataaggttagaagatacattgaaaagctagaaaattatgatgctgatgaaatc
gcttcattatgtatcgaacatgatttgaaagaagaagctttcgaaatttatgacaaacat
gaaatgtatagcaaggccttaaaggttatcgtcgaagatatcatttctttagacagggcc
caggaatatgttgaaaaaattaacagtaaggaattatggtctcaattaggtgcttctcag
ttagcaggtttacgtgttcctgaagctattgagtcatacatcaaagctgaagattcatct
aattttgaagcagttatcgatactgccgctgaagctggtaattatgagcagttaattcca
tatttaattatggctagaaaaacattgaaggaatctaagatcgacggttcattaatttta
gcctacgctgctttagataagattaatgaagttgaaaatatagtttcaaattcaaatgct
gccaatcttgaatctgttggtgacaaattattggccagcaagagctacaaggctgctaaa
ttatgtttcgctagtatttctaactattctaagttagcttcgaccttagtatttttgggt
gattatcaaaatgctgtcgacactgctagaaaagcatctaacattaaagtttggaaacaa
gtaaatgatgtctgtattgacaagaaggaattcagactagctcaaatttgtggtttgaat
ttaatcattcatgcagaagaactaaatgaattagtacataaatacgaatccaatggctac
tttgaagaattaatttcattattcgaagcaggtttaggtttagaaagcgcacacatgggt
atgtttaccgagttagcaatcctatacagtaagtatgaacctgcaaagacttttgaaaat
ttgaagttggtctggtctagaattaatattccaaaagttatcagagctgtcgaagaagct
catctatggaatgaagccgttttcttatacgctcattatgatgagtgggataacgctact
ttaacaatgattgaaaaatctaccaaatcttttgaccatgattactttaaagaaattgtt
gttaaggtttcaaatttggaaatatactacaaggctatcaacttttatgttaaagaacat
ccaatgttattaattgatttattaactgtcttaactccaagattggatattccaagaact
gtcaaaatctttaccaagtctgacaacctaccattaattaaaccattcttaattaacgtt
ttaccaaagaataactctgtagttagtgaagcatatcacgatttaatgatagaagaggaa
gactacaaagctttaactattgcagttgattcttatgataaatttgatcaattaggtcta
gcaagtcgtttagaacaacatgatttgatattttttaagaagatcgccgcattactatat
cgtagaaataagaaatgggctaagagtttaactattttcaagcaagaaaaattatggaag
gatgctatcgagacagcagctatttcacaagatcaaaaggtagttgaagatttattgaac
tactttgtcgaaatcgacaacaaagaagcattggttgcattattatacactgcttacagc
ctagttaaatttgactttgtcttagaattagcttggattaattctctggagaattacatc
aaaccattcgaaatttcaattaaaaaggaacaagctactatgattgaaaaactgtcaaag
gaattgaaatctaagggcaatgtttctaatgacgataataatagtgaccaaccattaatg
ttaaccaatggtatggggtattaa

DBGET integrated database retrieval system