KEGG   Tetrapisispora phaffii: TPHA_0E00770Help
Entry
TPHA_0E00770      CDS       T02235                                 

Gene name
TPHA0E00770
Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
tpf  Tetrapisispora phaffii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TPHA_0E00770 (TPHA0E00770)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:154048..155115
Genome map
AA seq 355 aa AA seqDB search
MSFFRSNTSSNQTMAADKDLMNDIVINNPAEDSISDIAFSPQQDFLFSVSSWDNKVRIWD
AQGGNPQGRAQYEHAAPVLCTRWSSDGTKVASGGCDNAIKIYDVASGQNQQLGTHNAAVK
SLRFVNCGPSNQECLVTGSWDKTLKYWDLRQPQPISTVMLPERVYSMDSKDKLLVVGTAD
RNICIIDLNSPGNIFKTFLSPLKWQTRAIACFNRGDSYAIGSIEGRCAIRYVDDMQQKNL
GFSFKCHRQNQNNNSMHANIYPVNSIAVHPVYGSFATAGSDGTFHFWDKDHRHRLKAFPS
QNATIPVVNFNRNGSVLAYALSYDWFQGYGGNKQGYPNVIKLHPTTDAEVQERKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcttccgttcaaatacaagttccaatcaaactatggcagctgataaagattta
atgaatgatattgttatcaataacccggcagaagattcaatatctgacattgcattctct
ccacaacaagactttttattcagtgtgagttcatgggataataaagtgcgtatatgggat
gcacaaggtggaaatccacaaggcagagctcaatatgaacatgcagctcctgtcttgtgt
accagatggtccagcgatggtacaaaagttgcatccggtggttgtgataacgctataaaa
atatatgatgtagcaagtgggcaaaatcaacaacttggaacacataatgcagccgttaag
agcttaaggtttgtaaattgtggaccttcaaatcaagaatgtttagtaacgggttcatgg
gataagacattaaaatattgggatttaagacaacctcaaccaatctctacagtgatgtta
cctgaaagagtttattctatggatagtaaagataaattattggtagtgggaacagcggat
agaaatatatgtattattgatctaaatagtcctggaaatatattcaagacttttttatca
ccattaaaatggcaaacaagggcaatagcatgtttcaatagaggtgatagttatgcaatt
ggttcgatcgaaggtagatgtgcaatcagatacgttgacgatatgcaacaaaaaaatctt
gggttttcattcaaatgtcaccgtcaaaatcaaaataataattcaatgcatgctaacatt
tatccagtcaatagtatagcagttcacccagtctatggatcgtttgctacagctggtagt
gacggaaccttccacttctgggataaagaccacagacacagactaaaggcattcccaagc
cagaatgcgactattccagtggtgaattttaacagaaacggttctgttttagcatatgca
ttaagttatgactggttccaaggctatggcggtaacaaacaaggctatccaaacgtcata
aagctgcatccaaccacagacgcagaagtccaagaaagaaagaaatag

DBGET integrated database retrieval system