KEGG   Tetrapisispora phaffii: TPHA_0E00870Help
Entry
TPHA_0E00870      CDS       T02235                                 

Gene name
TPHA0E00870
Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TPHA_0E00870 (TPHA0E00870)
Peptidases [BR:tpf01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TPHA_0E00870 (TPHA0E00870)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(174245..176392)
Genome map
AA seq 715 aa AA seqDB search
MAIKLKRWLSKSNKGNDKSNETSRPEEYNKCLEPKLATRQIIDNFEFNETTEHYEVPGIN
KTAQLLNSNSRALSESPTPVPLKDPRELVKNDSDHQKLLEITKLSDSSNKVFGYENFGNT
CYCNSVLQCLYNIPELRDNVIKYPMVPNEQKFNFKNTKTKVYDENSFDNNTRLLTVNNNN
SHNQNGTLKNLYKNNTQSSSQELLSKIPLQRRNSFKILASRDQSMLYSTSNSTNASFVSS
DQRADTEPTRGHVMASTPITEKIHEISVTTIVGRKKNIRQINILETGKYENNMAKPMGND
NDNDMELTDDAFENDETLENIKKIESSEGKKQTALISGPVLNIDTALNTNGKSNMYSALK
DIFDAITENNHLTGIVSPKELIETLKRENMMFNSMMHQDAHEFLNFLLNQISDNIESNMN
NPNNDNGEFGGLKFERNFINDLFQGVIKYTTRCLTCDNITSREELFLDFAIEVSNNEETN
IQEILGDYSQREMLNGSNKFFCDCCSGLQEAERIVGLKKLPETLILHLKRFKYSEEQNSN
IKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGGPQHGHYVSICKNEKYGWLLFD
DEVVVSITEESVLKFVGDPTTLTTAYLLVYKLKDEKYEENVSDIDYENNIKILLENDDFV
RKYVSQSSSLNEKATKQSVLEDVQEDDLYNEDRVDKTVPSSKSSKRRSKMFSFGL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggctataaaacttaaaagatggttgtccaaatccaataaaggaaacgacaagagtaat
gaaacttcaagacctgaggaatataataaatgcctggaacctaaactcgctacaagacaa
attatagataatttcgagtttaatgaaacaaccgaacattatgaagttccagggataaat
aagacagctcaattattgaattcaaattccagagctctttccgaatcacctactccagtt
cctttaaaagatccaagagaacttgtaaaaaatgatagtgatcaccaaaagttactagaa
ataacaaagttatcagatagttctaataaagtttttgggtatgagaactttggtaataca
tgttactgtaattctgttttacaatgtctttataacatcccagaattaagggataacgta
ataaaatatccaatggttccaaatgaacaaaaattcaactttaagaataccaaaacaaaa
gtttacgatgaaaacagttttgacaacaacactagattactaactgttaataataataac
tcacataatcaaaatggtactcttaagaatttatacaaaaacaacacacaaagtagttca
caagaattgttatcaaagatccctttacagagaagaaattcttttaaaattttggcaagc
agagaccaatcgatgctatattcgacgtcaaattcgacaaatgcgtcatttgtgtcttca
gatcaaagagcagatactgaaccaacaagagggcatgtaatggcatctacaccaataact
gaaaaaatccatgaaatttctgtaacaacaattgtgggtagaaaaaagaacatcagacaa
ataaatatattagaaaccggaaaatatgaaaataatatggcaaaaccaatgggaaatgat
aatgataatgatatggaactgacagatgatgcgtttgaaaacgatgaaacattagaaaat
attaaaaagatcgaatctagtgaggggaaaaaacaaactgcattgatcagtggaccagtg
ttaaatattgatactgctttaaacactaatggaaaatcaaatatgtacagcgcacttaag
gatatatttgatgcaatcaccgaaaataatcatttaactggtattgtttccccaaaagaa
ttgattgaaacattgaaaagggaaaatatgatgtttaattcaatgatgcatcaggatgct
catgagttcttaaactttttactaaaccaaataagtgataacatcgagtcaaatatgaat
aatccaaacaacgataatggagaatttggcggtttaaaatttgaaagaaatttcattaac
gatttattccaaggtgttataaagtatacgacgagatgtctaacttgtgataatattact
tccagagaggaattatttttagactttgcaatagaagtttctaacaatgaagagacaaat
atacaagaaattctaggagattattctcaaagagaaatgttaaacggctccaataaattt
ttctgtgattgttgtagtggtttacaagaagcagaaaggattgttggtcttaaaaaactt
ccagaaaccttgattttacacttgaagagatttaaatattcagaagaacaaaactcaaat
attaaattatttaataagattaactatccgttagtgcttcaagtttcatcaacgtctaat
tcagatatatcgaaatcatatgatttgaccggaatagtgcttcatctaggaggggggcca
cagcatggccattatgtttcaatttgtaaaaatgaaaaatatggttggctgctatttgat
gatgaagttgtcgtttccattacagaggaatccgtactaaaatttgtcggtgatccaact
accttaactacggcataccttttggtttataaattaaaggatgaaaaatacgaggaaaac
gtttcagacattgactatgaaaataatataaagatcctattagagaatgatgattttgta
agaaaatatgtctctcagagctcatctctaaacgaaaaggctacgaagcaatctgtatta
gaagatgttcaagaagatgatttgtataatgaagatagggtggataaaacagttccttct
tcaaagagttccaaaagaagatcaaagatgtttagttttggtttgtaa

DBGET integrated database retrieval system