KEGG   Tetrapisispora phaffii: TPHA_0E01020Help
Entry
TPHA_0E01020      CDS       T02235                                 

Gene name
TPHA0E01020
Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TPHA_0E01020 (TPHA0E01020)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(208049..210583)
Genome map
AA seq 844 aa AA seqDB search
MMVDSKVNDDTRKRKRASAILRSLIIDDNVHSEISKIARENPNKLMKSKRNTTVNVNYVP
RKFHNVIVQGDDVGSRNPSRRNSRRKTSSLTRRKQHRRRLDSLSSATQRSRIKGNTTTSI
KQSPVNEFTLPYVVEQMWELPGTVEELNSLNNKLHYITDVKNPNLIDNNDYTITGVKIKF
NPLNFLNFSNIVNRSKVEAQLNSKLHNDAVNTDFDVYQAESLISAIDNANELPYRGVIAN
SKDFLTSRTAPTISDRIQFKEILDQSLSASYCNANILMCNHSKAEDIDENKRNKRKKIST
TQNQNMLSNTLSSAIEYIYLSGYEIKTWYSAPYPEEYNKNKLLYICQHCLKYMNSRFIYF
RHITKCRQAHPPGNEVYRDGKLSIWEVDGRENIVYCQNLCLLAKLFLNSKTLYYDVEPFI
FYVLTELDESDENNPKWNFVGYFSQEKLNSTDYNLSCILTLPIYQRKGYGQLLMEFSYLL
SKVAYKWGTPEKPLSNLGLLSYRNLWKIKCAKVLLMLKKRFKDFCRPIGITLEDISDFTG
MIPTDVVIGLEQLQVLYMNKHVVVTNSAETIKTNKDKNTLVNYRIQIDSWTRIEKICNQW
KEKNYPEIRPEKLIWKPMLFGPSGGINAVGSLIETPPKPNDGDIITNSQTEDHFNKSIKL
LSNFMNDDISDPRSMEQIAWDRIKDRSESDIELSNSQQGKWVPSFIEPIIPNNTKLLKKN
SFQIQKNNSEASDNGTVDLEVLDNEEIIDEEEVYIEDEVEGNDEDEVEYQVEDEDDEDDG
DQDEDDDGYEELKPISKQRRKRYVSPTANVTLRRSSRKLRQDLSSSVDENLELPPLRRST
RTRR
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgatggtagatagtaaggtgaatgatgatacgaggaagaggaagagggcaagtgcaata
ttgcgtagtttgatcattgacgataatgtgcattctgaaatatcaaaaattgcaagagaa
aatccaaataagttaatgaaaagtaagagaaatactactgtaaatgttaattatgttcca
agaaaatttcataatgttattgtacaaggtgatgatgtaggtagtcgaaatccaagtcgc
cgtaacagtagaagaaaaactagttctttaacaagaagaaaacaacatagaagacgatta
gatagtctgtcctcagctacacaaagatctaggataaaaggaaatacaacgacatcaatt
aaacaatcaccagtgaatgaattcactcttccatatgttgtggaacaaatgtgggagtta
cctggcacagtggaagaattaaactctttaaataacaaattacattacattactgatgtt
aaaaatccaaatctaatagacaacaatgattatacaattactggcgtaaagattaagttt
aatccattaaattttttaaatttttcaaatattgtaaatagatctaaagttgaagcacag
ttaaattcaaaacttcataatgatgctgtaaatactgactttgatgtttatcaagctgaa
tcgcttataagcgcaatagataatgctaatgaattaccatacagaggagtaatagcgaat
tcaaaggattttttaacatcaagaacggcaccaacaataagtgataggatacaattcaaa
gaaatattagatcagtcactttctgcatcttattgtaatgcgaacattttaatgtgtaat
catagtaaagcagaggatattgatgaaaataaaagaaataagagaaagaaaatttctact
acacaaaatcaaaatatgttaagtaacaccttatcaagtgctatagaatatatttattta
tcaggttatgaaatcaaaacttggtattctgcaccatatccagaggaatacaataaaaac
aaactattatatatatgtcaacattgtttaaagtatatgaattcaagatttatatatttt
agacatattacaaaatgtcgacaggctcatccaccaggaaatgaggtatacagggatggt
aaattgtcaatttgggaagttgatggaagagaaaacatcgtatattgtcaaaatttgtgt
cttttggctaaactttttctaaattcaaaaacattatattatgatgtcgaaccattcatc
ttttatgttttaactgagttagacgaaagtgatgaaaacaacccaaaatggaattttgtt
ggttatttttcccaagaaaagttaaattctactgattataatttaagttgtatattaact
ttaccgatttatcagcggaaagggtacggtcaattattaatggaattttcatacttatta
tctaaggtagcatataaatggggaactccagaaaaacctctttcaaatttgggtttattg
tcatatagaaatttgtggaaaatcaaatgtgcaaaagtgctacttatgttaaaaaagagg
ttcaaagatttttgcagaccaatcggtattactttagaagatatatctgactttacaggt
atgatacccacagatgtagtgattggtttggagcagttacaagtattatatatgaacaaa
catgtggtagtcactaattctgctgaaacaattaagacaaataaagataaaaatacgcta
gtaaactatcgaatccagattgactcttggacaagaattgaaaagatttgtaaccaatgg
aaagaaaaaaattatccagaaattcgaccagaaaaattaatttggaaacctatgcttttt
ggaccatctggcggtatcaatgcggttggctcgctgattgaaactccaccgaaaccaaac
gatggtgacataatcacaaactctcagactgaggatcatttcaataagagcataaagtta
ttatcaaattttatgaatgatgatatatcagatccaagatcaatggagcaaatagcatgg
gataggattaaggatcgtagtgaaagcgatatagaactatcaaattcacagcaaggaaag
tgggttccttcatttatcgagcctattataccaaataacacaaaactactaaagaaaaat
tcttttcaaattcaaaaaaataattcagaagcatcagataacggcactgttgatttagaa
gtcttagataatgaagagattatcgatgaagaagaggtctatattgaagacgaagttgaa
ggaaatgatgaggatgaggttgaatatcaagtagaagatgaagatgacgaagatgacggt
gatcaggacgaagacgacgatggatacgaagaattgaagcctatttcaaaacaaagaaga
aagaggtatgtttcgcccactgctaatgttacactaagaagatcatctaggaaacttcga
caagatttatcatcgtcggtggatgaaaatttagaattacctccactaagaaggagtaca
cgtactagaagatga

DBGET integrated database retrieval system