KEGG   Tetrapisispora phaffii: TPHA_0E01330Help
Entry
TPHA_0E01330      CDS       T02235                                 

Gene name
TPHA0E01330
Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPHA_0E01330 (TPHA0E01330)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TPHA_0E01330 (TPHA0E01330)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TPHA_0E01330 (TPHA0E01330)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TPHA_0E01330 (TPHA0E01330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:267849..269147
Genome map
AA seq 432 aa AA seqDB search
MTTNYTIVIKMGSSSLVDEETKEPKLALMSLLVETVVKLRREGHRIVIVSSGSIAVGLRT
MKMDKKPKHLAGKQALAAVGQGRLIARWDLLFSHFNQRIAQVLLTRNDISNWPQYKNAQN
TLNELLNMDVIPIVNENDTLSTNEIQFGDNDTLSAITAGAVDANYLFLLTDVDCLYTANP
KENPDAKPLLIIPNISEGLPGVDTSSGSGSSVGTGGMETKITAANLATNAGVHTIIMKSD
RPKNICSIVHYIRSLDLNLDEEDKKERFGDIDLLDLQVKELKKLKEMGVPLHTKFIANDN
QHHLKNREFWILHGLMTKGSVIIDQGAHSALTRKNKAGLFPAGVIGVEGTFHEFECVELK
MGKRLASGEMDPDFTPIVFGRARCNYSSDELVKIMGLQSSEIEDALGYVDSEYVAQRDNI
ALPPNDTDRTIE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaattatactattgttattaagatgggttcttcatcgttggtcgatgaggag
actaaagaaccaaaattagcgttgatgtccttactagttgaaactgttgtgaaattaaga
agggagggacatagaattgtcattgtctccagtggcagtattgcagttggtctaagaacc
atgaagatggacaagaagccaaaacatctagctgggaagcaagctcttgctgctgtcggt
caaggcagactaattgctagatgggacctgttgttttcgcatttcaaccaaagaatagcc
caggtgctgttaaccagaaacgacatatctaactggcctcaatataagaatgcgcaaaac
acattaaatgaactattaaatatggatgtcattccaattgtaaatgaaaacgacacttta
tccaccaatgagatccagttcggtgataacgacacattgagtgcgatcacggccggtgca
gtggatgccaactacttatttctgctaacggacgtcgactgcctgtacactgccaaccct
aaggagaaccctgatgccaagccattactaatcatcccaaacatttctgaaggtttgccg
ggcgttgatacgtcttcagggtccgggtccagtgtcggaacaggcggtatggagaccaag
ataaccgccgccaacctagccacgaacgcgggtgtgcacacgataatcatgaaaagtgat
agacctaagaatatctgttccattgtgcattacatccgaagtcttgatttgaatctggat
gaggaggataagaaagaaagattcggcgatatcgatctactagacttgcaagtgaaggag
ctgaaaaaactgaaggagatgggcgttccactgcataccaagttcatcgccaatgataac
caacatcatttgaagaatagagagttctggatattgcatggtttgatgacgaaaggttct
gttatcatagaccaaggcgcacacagcgcgcttacccggaagaacaaggcaggactgttc
ccagctggtgtgattggagtcgagggcacattccacgagtttgagtgtgtcgaattgaag
atgggtaagcgcttggcatctggagagatggacccggatttcacacctatcgtattcggt
agagcaagatgtaactactccagcgatgagctggtcaagatcatgggactacaaagcagc
gagatcgaagatgcattaggatacgttgacagcgagtacgtcgcacaaagagacaacatt
gcattgccaccaaacgacacggataggacaatagaataa

DBGET integrated database retrieval system