KEGG   Tetrapisispora phaffii: TPHA_0E01740Help
Entry
TPHA_0E01740      CDS       T02235                                 

Gene name
TPHA0E01740
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
tpf  Tetrapisispora phaffii
Brite
Exosome [BR:tpf04147]
 Exosomal proteins
  Proteins found in most exosomes
   TPHA_0E01740 (TPHA0E01740)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(352358..352370,352454..352821)
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG
LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY
LIGVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacactgataacttattggctactggaaaagtagacaaggccgct
ttatactctagagcaggtgatgctgcatgggctgcttctggtggtttgagtttaactgcc
caagaagctaccgaaattgctaaaggtttcgatgatccatctggtttacaaactactggt
ttgcacattcaaggtcaaaaattcatgttattaagggctgatgacagaagtatctacggt
agacatgatgctgaaggtgttgtttgtgtcagaaccaaacaaactattattattgctcat
tacccaccaactgttcaagctggtgaagctaccaagatcgttgaacaattggctgactac
ttgatcggtgttcaatactag

DBGET integrated database retrieval system