KEGG   Tetrapisispora phaffii: TPHA_0E02140Help
Entry
TPHA_0E02140      CDS       T02235                                 

Gene name
TPHA0E02140
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TPHA_0E02140 (TPHA0E02140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:445640..447712
Genome map
AA seq 690 aa AA seqDB search
MNKTDIIVLGVLVVCVLLYTKRETIKAIIADIIGGDDSDISADSSGSRDIAQVLSQNNKN
YLVLFASQTGTAEDYAKKFAKELTSKYQLNVMCVDVENYDFETLNDIPSKCMVSLFISTY
GEGDFPDGAVKFEDFLSEAADSNGLANISISTFGLGNSTYEFFNGAGKKAVEHMTNAGAT
IVGDLGCGDDAAGTTDEDYMAWKERIFEELKEKLQLDEHDESFESSFKYEPLESITDDVS
LGEPSFQYLPASKLSFNDAGIQLGPFDASHPYVAPFVKSVELFKSDDRNCIHSEIDISGS
NMKYTTGDHLGIWPSNANEKVDQFLKVFGLNGKNIFNLTPKDATVKVPFPVPTTIDSAVR
HYLEITGPIARQLFAQLVEFAPNEEIKKKLTVLSQDKDLFAKEITSKKFNLADALLYLSN
GEYIWTSVPWEFLLENVSPLLPRYYSISSSSLSEKQTIHITSVVENSPNEHAEIGNTIGV
ATNLIRNIQLAQNKVDIASSNLPVTYDLSGPRDLFSGFKLPMHVRRSTFRLPTNPSTPVI
MIGPGTGVAPFRGFIRDRVHMVDTQENVKFGKHMLFYGSRNTDDYLYQEEWPEYAKKLDT
SFEMITCHSRIPGQKKVYVQDMLSERAADISTLINDGAFIYVCGDAGRMAKDVNSVITNI
ISSNKGISTEDAAEIVKMLKTSGRYQEDIW
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagactgatatcattgttttaggtgttttagtcgtttgtgttctattgtataca
aagagagaaactatcaaagctatcatcgctgatataatcggtggtgatgatagtgatatt
tctgcagattcctcaggaagtagagatatagctcaagttttatcacagaataataaaaat
tacttggttttgtttgcttctcaaactggtacggctgaagattatgctaagaagttcgca
aaggaactgacttcaaaatatcagttgaacgttatgtgtgttgatgttgaaaattatgat
tttgagacgttgaacgatatcccttcaaaatgcatggtttctttattcatttcgacttat
ggtgaaggtgatttcccggatggtgccgtcaagttcgaagatttcttatctgaagctgcc
gactctaacggtttggcaaacatatcgatctctacttttggtttgggtaactctacttac
gaattcttcaatggtgcaggtaagaaggctgtcgagcacatgaccaatgcgggtgccacc
attgttggtgacttgggctgtggtgatgatgccgctggtactactgatgaagattacatg
gcctggaaagaacgtattttcgaagagttaaaggaaaaattacaactagatgaacatgat
gaatctttcgaatcctcgttcaaatacgaacctttggaatccatcaccgatgacgtctcc
ctcggtgaaccatccttccaatacctacctgcttctaaattatccttcaacgatgccggt
atccaattaggtccattcgatgcttctcacccatacgttgctccatttgttaaaagtgtt
gaattgttcaaatcggacgaccgtaactgtattcactctgaaattgatatctctggctct
aacatgaaatataccaccggtgatcatttgggtatttggccatctaatgctaacgaaaag
gtagaccaattcttaaaagtctttggtctcaatggcaagaatattttcaacttaactcca
aaagatgctaccgtcaaagtcccattccctgtcccaacaaccattgattctgctgttaga
cattacttagaaattactggtccaattgctagacaattatttgctcaattagttgaattt
gctccaaatgaagaaattaaaaaaaaattaactgttttatcgcaagacaaagacttattt
gctaaggaaatcacttcaaagaagtttaaccttgctgacgctctactatacttatctaat
ggtgaatatatctggacatctgttccatgggaattcttgcttgaaaacgtttcaccgtta
ttaccacgttattactccatttcttcttcttccttatctgaaaagcaaactattcatatc
acctcggttgttgaaaactctccaaatgagcatgctgagattggtaatactattggtgtg
gctactaacttgattagaaatattcaattagctcaaaacaaggtcgatattgcttcttct
aacttaccagttacttatgacttaagcggtccgcgtgatttattcagtggcttcaaatta
ccaatgcatgttagacgttctacttttagattaccaactaatccatccactccagttatt
atgatcggtccaggtaccggtgttgctccgttccgtggtttcattagagatcgtgttcat
atggttgacactcaagaaaatgtcaaattcggaaagcacatgctgttctacggttctaga
aatactgacgattacttatatcaagaagaatggccagaatatgccaagaaattagatact
tctttcgaaatgatcacttgccactccagaatcccaggtcaaaagaaagtctacgtccaa
gatatgctttctgaacgtgctgctgatatatctactttgatcaacgatggtgctttcatt
tacgtttgtggtgatgctggtagaatggctaaggatgttaatagtgtcattactaacatc
attagttccaacaagggtatttccaccgaagatgctgccgaaattgttaaaatgttaaag
acttctggcagatatcaagaagatatttggtaa

DBGET integrated database retrieval system