KEGG   Tetrapisispora phaffii: TPHA_0E02340Help
Entry
TPHA_0E02340      CDS       T02235                                 

Gene name
TPHA0E02340
Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tpf  Tetrapisispora phaffii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tpf03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:494049..499073
Genome map
AA seq 1674 aa AA seqDB search
MNWNPLLLQSLYASIEAGDIDYELFKQCLPDLANLNLKDSFPKNHQSRTSLEKGTLEING
TTYKLNKEFIFAAIKISDDLNLDELAITKLLINSQNDPQKSNNTNDSISLINLGKVQYYL
SRQYILQIVNYIVNCSTPGDKLWDGLLSTKSNNQNSIATNILLAFDNIHKELREIKESID
KAMLLDITNTIVFKKDIKFRRDFLLKEYDILSTTMFGLVNHGTLLNKQFVIDIINNVSKL
DANDYFIVYHIPSIIQAFVILDEMNDQDVLALHSKFIQDLTSDGEIYTKPIKVTIIFLFL
CYFIGWCKKKPDSRAVNIDFKTQIDEPMMKAVSLGALEQLLILTADTSETLKTGLSNIYY
DMRALLERHIPRLVPVQLYETSNGLQQKHMLNALSSTGSSLDITSTGSPVISLSEQSESI
FLTTLNNAIQTIISNGAFLLTKIKDEEEDSLLSGEDLNLDDISVKADLERFFLATYYFFF
NRPSLSKEFWSDNESDAYGFIEWASKCTDSLMRSCFYIMISGLSHNEENSLNIYHFFNNG
NTVSWAIISQCISDYIIKINNLTQVISLRQQQNETEDVDQTTIALEEGLNEETIIFLSSL
LSLIGSVAKDINYEFKEKISEIFIDILFEFVKVETPLVGAIFKTISHLVHRDETKRIKIW
RSLDTLIFSNTFTLPSSDSYKTSFSSLLGSYSEIMGFLNLFHSLTENESLASDNNFLTFG
KLTFPERLGQGYRKVGVWPYYEYILNELFVNSFKMRDYQKKEQLQLTILNIITNGLSSFD
YSVILNSNIANVDLNKLVSTTNFFSYVHESAAVVLFNYIFTEKIFTGIYKLMSIGVDNLR
IDIDGGHEQKMLIQSSLQIVKMIFKYQDTYLEELCPIIVKQRIDNYFVPRRFGSHGLKSF
FDTVVFNLSAIAHLGLYIGSDDNKLASESLQILQIISLRYNNDNFGSNIILTTFDSVDES
ARIKESFIFRIDRPIETLSDLSVKLGILDYIADNLTFNDLQPTVSHLLLGFQVTNIISMG
PDLNTFISSGTSLLQSLINLLISALNALSPNNVNYAPMRLASQSIGILMKLCRNPLTANL
TLDYLAEQELFSTLLSIGPQVSKYTQWNGRMYDNNSAEDCKIFIETESIGALLSFLSFRG
CLLQYLSLSIHRLSFHGTPSQTKLLIEELTSNAMYSAGIFSFLDSSNLGNFHKEHDLRQN
LNHFKFLPISLENIQLTNYLEGNIYDFTNLNSLLNLYTRSKLSTSLNSTNPELEKEIKSE
YSRVKQFATNNISHSRVLELLLLNVHTWVQLVQIVVTDGGMETLTRSNFILQVFSTVVPK
INDYVEYDIAFSEELVSLCVFLFDIYHKDCQGIGAQNKFDVRLYELFKACIHGINSSVTS
PSLRSDFYVLANNYLTDILKDEYMVKNILHDLQMNSSRLIDIICSDAVSGEGTNRITSIL
LLDSLFQLGTHNKDNFILESLASGTHLLLLILSIKNIDSHFKISLDNVTLSSFLYELTVL
KTTVNMLTRIAQYKGGAQLLIRNKLFSSIEECDYLSLDPDVGLNLLLENINGNKINTLSF
NVTRENMLQAHEDPNNISLLELYIPIFQLLSAVVIVMGSSNKSTLQSVRGLLNKHNKLCS
SILKKSTLIHSSVDKDDQNPSKENLKILTRLIVILCSLTSYQTDNMSNMFVEIK
NT seq 5025 nt NT seq  +upstreamnt  +downstreamnt
atgaattggaatccattgttattgcaatcattatatgcctctatcgaagcaggcgatata
gactatgaactatttaaacaatgtttacctgatctagctaatttgaatcttaaagatagt
ttcccaaaaaatcaccaaagcagaacttcattagaaaaaggaacgttagaaatcaatggt
accacttacaagttaaataaagaattcatttttgctgcgattaaaatatctgatgattta
aatctagatgaattggctattaccaaacttctaattaattcgcaaaatgatccacagaaa
tcaaacaatacgaatgatagcatttcattaataaatttgggaaaagtacaatattatttg
tcaagacaatacatcctgcagatcgtaaactatattgttaattgctctactcctggtgat
aaactatgggatggattactttccacgaaatctaacaaccaaaattccattgctacaaat
attttgctagcttttgataatatccacaaggaattaagagaaattaaagaatctatcgat
aaagcaatgcttttagatattacaaatacaattgtgttcaagaaagatattaagttcaga
cgtgatttcttattgaaagaatatgatattttgagtactacaatgtttggtttagttaac
catggaacattattaaacaagcaatttgtaatagatattattaataacgtttcaaaacta
gatgcaaatgattattttatagtttatcatattccatctattattcaagcatttgttata
ttagatgagatgaacgatcaagacgtgttagcattgcattcaaaattcatacaagattta
acttctgatggagaaatttatacaaagccgattaaagtaactattattttcctattttta
tgttactttatcggatggtgcaaaaagaaaccggacagtagagctgtgaatatcgatttt
aagacacaaattgacgagcctatgatgaaagctgtctcattaggtgctctagaacaattg
ttaatattgacagctgacacttcagaaactttaaaaacaggattgtcaaatatttattat
gatatgagggctttactagaaagacatataccgagattagtcccagttcaattatacgag
acgagcaatggtttacaacaaaagcatatgctcaatgcattgtcctcaacaggttcatca
ttggatataacttccacgggaagtcctgtaatctcgctctcagagcaatcggaaagtatt
ttcttaacgactttaaataatgctattcaaactattataagtaatggtgcatttttactg
acaaagattaaagatgaagaagaagattctcttttatctggagaggatttaaatttggac
gatatatctgttaaagcagatcttgagcgcttcttcttagcaacctattatttctttttt
aatcgtccgtccctatcaaaggaattttggtcagataatgaatctgatgcatatggattc
attgagtgggcatcaaaatgtactgatagtttaatgagatcatgtttttacataatgatt
tctggtttatcacataatgaagagaattctttaaacatttatcatttctttaataatggt
aatacagtttcatgggcaattatttctcaatgtattagtgattacataattaagatcaat
aacctaacacaagttatatcactgagacagcaacaaaatgaaacagaggatgtcgatcaa
acgactatagccttagaggagggtcttaatgaagaaaccatcatatttttgtcatctttg
ttatctttaataggctctgtggctaaagatattaattatgaattcaaagagaaaatttca
gaaatattcattgatattttatttgaatttgttaaagttgaaacacccttagtgggtgct
atctttaagacaatcagtcatcttgtccacagagatgagaccaaaagaatcaaaatttgg
agatcattagacactctaattttcagtaacacatttactctaccaagtagcgactcttac
aaaacgtcatttagttcattattgggtagctattcggagataatgggatttttaaatctg
ttccacagcttaacagaaaatgaatctcttgcttcggataacaacttcttgacttttgga
aaacttacatttcctgaaagattagggcaaggttatagaaaagttggtgtatggccatat
tatgaatatattttaaatgaactatttgtgaactcattcaaaatgcgagattatcaaaaa
aaagaacaacttcaattgaccatacttaacataataactaacggtttaagttcgttcgat
tattctgttatactaaattccaatattgcaaatgtagatcttaacaaactagtaagcacg
actaacttttttagttacgttcatgaatctgctgcagttgtgctttttaattacattttt
actgaaaagatatttacaggaatctataaactgatgtcaataggtgttgacaatttaaga
attgatatcgatggtggacatgaacaaaaaatgttgatccaaagttctctacagattgtg
aagatgatatttaaatatcaagatacctatttagaagaactctgtccaatcattgttaag
caacgtattgataattacttcgttccgcgaagatttggctctcatggattgaagtcattt
tttgatacagtggtttttaacttgtctgcgatagcacacttaggtttatacatcggatct
gatgacaataagttagcatctgagtctcttcagattttacagataatatccctcagatat
aacaacgataactttggcagtaacataatcctaacaacttttgattctgtcgatgaatct
gctagaattaaagaatcgtttatttttagaatagatcgaccaattgaaacgctttctgat
ttatcagtaaagctgggaatattagattacattgctgataatttaactttcaatgatctc
caacctacagtatctcatttattgcttggatttcaagtcacaaatattatatctatgggg
cctgatctgaatacatttattagctcaggaacatctttactacagtcactgataaacttg
ctgatttctgccctcaatgccttatcacctaataacgtaaattatgctcctatgagactt
gcttctcaaagcattggaatactgatgaaattatgtcgtaacccactaactgctaattta
acattagattatttagctgagcaggaattattttccacattattatcaattggtccacaa
gttagtaaatatacacagtggaatggcagaatgtatgataataactctgctgaagattgt
aaaatttttattgagaccgagtcaataggtgccttactctcatttttatcattcagaggt
tgcttactccaatatttaagtttatccatccatagactttcctttcatggaactccatct
caaacgaaattattaattgaggaattaacttcgaatgctatgtactctgctggaatattt
tcttttctggattctagtaatttaggtaattttcacaaggaacacgatctgaggcagaac
ttaaatcattttaaatttttacctatttcattggagaatattcagctgacaaattatctc
gaaggtaacatttatgattttacaaatttaaattccttattgaatttatacactaggtca
aaactttcaacaagcctaaattccactaacccagaacttgaaaaagaaatcaagagtgag
tattctagagtcaagcagtttgcaacaaataatatcagccacagccgtgtgttagagtta
ttattattgaacgtgcatacatgggttcagctagttcaaatagtcgtaaccgatggaggt
atggaaaccttaactcgatcaaacttcattttacaagttttcagtactgttgtaccaaaa
atcaatgattatgtcgaatatgatatagctttttcggaagaactggtatcattgtgtgta
ttcttatttgatatataccacaaggattgccagggtattggcgcccaaaataaatttgat
gtccgcttatatgaattatttaaggcttgtattcatggtatcaattcttcggtgacatct
ccatcgttgagatcagatttttatgtgttagcaaacaattacttaactgatattttaaaa
gatgaatatatggttaaaaacatactacatgatcttcagatgaatagtagcagattaata
gatattatatgcagcgatgcagtatcaggagagggaacaaaccgtataactagtatttta
ttgctagactcgttatttcaactcggaacccacaataaagataattttattttagaatca
cttgcatcaggtactcatcttcttctattaatactttccattaaaaatattgattcacat
ttcaaaatatcgcttgataatgtaactctttcttcatttttatatgaattaactgtgctg
aagactactgtaaatatgctcactcgtatagctcagtacaaaggaggtgctcaattattg
attcgcaacaaacttttttcctcaattgaagagtgcgattacctaagtctagatcctgat
gtaggcttgaatttgcttcttgaaaatattaatggcaacaaaattaatacactaagtttt
aacgttaccagggagaatatgctacaagctcacgaggatccaaataatatttcattgctt
gaactatatattcctattttccaattattatctgctgttgttatcgtcatgggtagttca
aataagtcaactttacaaagcgttagaggtttattaaataaacacaacaaattgtgttca
agtattttgaaaaaaagtactttaatccattctagtgtggataaggacgatcaaaatcca
agtaaagagaatctaaaaattttgacaagattaattgttatcctctgtagtttgacttca
tatcaaacagataacatgtcaaatatgtttgttgaaattaagtaa

DBGET integrated database retrieval system