KEGG   Tetrapisispora phaffii: TPHA_0E02400Help
Entry
TPHA_0E02400      CDS       T02235                                 

Gene name
TPHA0E02400
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tpf  Tetrapisispora phaffii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tpf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:511507..512406
Genome map
AA seq 299 aa AA seqDB search
MFARVLRTNPKYIPLTVGAAAILIGAAYNFAVSRNNFISNSSGKVLVGDGKWVDIPIAKI
ENLSSDTKKFTFKLPSEDDVLGTEYASAILAKFVTPKGSNVIRPYTPVSPVDTKGNFELV
IKHYEGGKMTEHLFGLKENDTVAFKGPMLKWKWIPNGFKEVTLIGGGTGITPLFQLIRAI
CENPNDKTVVKLFYGSKSPSDILLKKDIDEFQKQFPNQLKVTYFVDKSEDKTDYKVGYIS
KDFVRENCSKPAKDSHVFICGPPGFMDALSGQKKSPTDQGEITGIFKELGYTNDDIYKF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaagagtgttaagaacaaatccaaaatatatccctttaactgttggagcagca
gcaatcttaattggtgctgcatataactttgctgtctcgagaaacaatttcatttctaat
tcatcaggaaaagttcttgttggtgatggcaagtgggtggacatacctattgcaaagata
gagaatctttcttccgatacaaaaaaattcacatttaaattaccttctgaagatgatgtt
ttagggactgaatacgcttctgctatcttagctaaatttgttactccaaagggttccaat
gttataagaccctataccccagtatctccagttgatacaaaaggtaacttcgaattagtt
attaaacattacgaaggtggtaaaatgactgagcatttgtttggcttgaaagaaaacgat
actgttgctttcaaaggaccaatgttaaaatggaaatggattcctaatggtttcaaagaa
gtcaccttaattgggggtggtactggtatcacaccattgttccaattaattcgtgccata
tgtgaaaacccaaatgataaaactgttgttaaactcttttacggtagtaagtcaccttct
gacatcttattaaagaaagatatcgacgaattccaaaaacagtttccaaatcaattaaaa
gtcacgtattttgtcgacaagagtgaagataaaactgactacaaggttggttatatttct
aaagattttgtccgtgaaaactgttcaaaacctgcaaaagattctcacgtcttcatttgt
ggtccacctggattcatggatgccttatccggtcaaaagaaatctccaactgatcagggt
gaaataactggtatatttaaagaattaggatataccaatgacgacatctataagttttaa

DBGET integrated database retrieval system