KEGG   Tetrapisispora phaffii: TPHA_0E02840Help
Entry
TPHA_0E02840      CDS       T02235                                 

Gene name
TPHA0E02840
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:tpf04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:594381..595589
Genome map
AA seq 402 aa AA seqDB search
MDSNIKEYPAPSNDTSVYQQQQQQQLYQRQQLQQQHQLQQGQQYYYETAKSDQQPQASLA
PFPGDGTDSSNSQHLVFQKSSVSKGKYTLQDFQILRTLGTGSFGRVHLVRSIHNRRYYAI
KVLKKQQIIRMKQIEHTNDERRILKMVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSL
LRKSQRFPNPVAKFYAAEVILALDYLHSHGIIYRDLKPENLLLDRLGHIKMTDFGFAKEI
STVTWTLCGTPDYIAPEVVASKPYNKSVDWWSLGILIYEMLAGYTPFYDTTPMKTYEKIL
NGKVNYPSFFHPNIVDLLSNLITADLTRRFGNLQSGAEDIKSHAWFSEVVWSKLLARDIV
TPYEPPIQSEVGDTSLFDQYPEEHFDYGIQCEDPYTQYFTDF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaatattaaagaataccctgctccttcgaatgatactagtgtgtatcaacaa
cagcaacagcaacaattgtatcaacgacaacaattacaacaacagcaccaattgcaacag
ggtcagcaatattactatgaaactgcaaagagcgatcaacaaccccaagctagtttagct
ccctttccaggtgatggaactgattcttccaattctcaacatttagtattccaaaaatct
tctgtctccaaagggaaatatacgttacaagattttcaaatattgagaactcttggtaca
ggctcttttggcagagttcatctagtgagatcaatccacaatagaagatattatgcaata
aaagttttgaagaagcagcaaattatcagaatgaaacaaatagaacatacaaacgatgag
agaagaatcttgaaaatggtagaacatccatttttaataagaatgtgggggactttccag
gactccagaaatttattcatggtaatggattatattgaaggtggtgaattattttcattg
ttgagaaaatcgcaacggttcccaaacccagtggctaaattttacgcagctgaagttata
ttagccttggattacttacattcacatggtataatttatagagatttaaaacctgaaaat
cttctactagatcgtttaggtcatattaaaatgactgattttggtttcgcaaaagaaatt
tctactgttacttggactttgtgtggtactcctgactatattgccccagaagtggtagcc
tctaaaccttacaataaatctgtagattggtggtccttgggtatcttaatatatgaaatg
ttggccggttatactccattttatgatacaactccaatgaaaacttatgaaaagatattg
aacgggaaagtaaattatccatcctttttccatccaaatattgtagatttattatcaaat
ttgataacggcagatttaacaagaagattcggtaatttacaaagcggagcagaagatata
aaatcacatgcctggtttagtgaagttgtatggtcaaagctacttgcaagggacattgta
acgccatatgaaccaccaattcaatcagaagtcggtgatacatcattatttgatcaatat
ccagaagaacatttcgattatggtattcagtgtgaagacccatatacacagtatttcaca
gacttttaa

DBGET integrated database retrieval system