KEGG   Tetrapisispora phaffii: TPHA_0E02840Help
Entry
TPHA_0E02840      CDS       T02235                                 

Gene name
TPHA0E02840
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    TPHA_0E02840 (TPHA0E02840)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TPHA_0E02840 (TPHA0E02840)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TPHA_0E02840 (TPHA0E02840)
Messenger RNA biogenesis [BR:tpf03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TPHA_0E02840 (TPHA0E02840)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:594381..595589
Genome map
AA seq 402 aa AA seqDB search
MDSNIKEYPAPSNDTSVYQQQQQQQLYQRQQLQQQHQLQQGQQYYYETAKSDQQPQASLA
PFPGDGTDSSNSQHLVFQKSSVSKGKYTLQDFQILRTLGTGSFGRVHLVRSIHNRRYYAI
KVLKKQQIIRMKQIEHTNDERRILKMVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSL
LRKSQRFPNPVAKFYAAEVILALDYLHSHGIIYRDLKPENLLLDRLGHIKMTDFGFAKEI
STVTWTLCGTPDYIAPEVVASKPYNKSVDWWSLGILIYEMLAGYTPFYDTTPMKTYEKIL
NGKVNYPSFFHPNIVDLLSNLITADLTRRFGNLQSGAEDIKSHAWFSEVVWSKLLARDIV
TPYEPPIQSEVGDTSLFDQYPEEHFDYGIQCEDPYTQYFTDF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaatattaaagaataccctgctccttcgaatgatactagtgtgtatcaacaa
cagcaacagcaacaattgtatcaacgacaacaattacaacaacagcaccaattgcaacag
ggtcagcaatattactatgaaactgcaaagagcgatcaacaaccccaagctagtttagct
ccctttccaggtgatggaactgattcttccaattctcaacatttagtattccaaaaatct
tctgtctccaaagggaaatatacgttacaagattttcaaatattgagaactcttggtaca
ggctcttttggcagagttcatctagtgagatcaatccacaatagaagatattatgcaata
aaagttttgaagaagcagcaaattatcagaatgaaacaaatagaacatacaaacgatgag
agaagaatcttgaaaatggtagaacatccatttttaataagaatgtgggggactttccag
gactccagaaatttattcatggtaatggattatattgaaggtggtgaattattttcattg
ttgagaaaatcgcaacggttcccaaacccagtggctaaattttacgcagctgaagttata
ttagccttggattacttacattcacatggtataatttatagagatttaaaacctgaaaat
cttctactagatcgtttaggtcatattaaaatgactgattttggtttcgcaaaagaaatt
tctactgttacttggactttgtgtggtactcctgactatattgccccagaagtggtagcc
tctaaaccttacaataaatctgtagattggtggtccttgggtatcttaatatatgaaatg
ttggccggttatactccattttatgatacaactccaatgaaaacttatgaaaagatattg
aacgggaaagtaaattatccatcctttttccatccaaatattgtagatttattatcaaat
ttgataacggcagatttaacaagaagattcggtaatttacaaagcggagcagaagatata
aaatcacatgcctggtttagtgaagttgtatggtcaaagctacttgcaagggacattgta
acgccatatgaaccaccaattcaatcagaagtcggtgatacatcattatttgatcaatat
ccagaagaacatttcgattatggtattcagtgtgaagacccatatacacagtatttcaca
gacttttaa

DBGET integrated database retrieval system