KEGG   Tetrapisispora phaffii: TPHA_0E03250Help
Entry
TPHA_0E03250      CDS       T02235                                 

Gene name
TPHA0E03250
Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(690693..691775)
Genome map
AA seq 360 aa AA seqDB search
MSFARTLNKRSVYLFGAVAGAAAAASMASQSEFSKFSYNNSNNNNNNNRHNNFSRFTKAG
LFGIGAASASHPNVANPDKTKTIEDYQKIYNVIAKKIQDEDEHDGYIGYIPILVRIAWHS
SGTYDKESGTGGSHGGTMRHAKELNDPSNAGLHTAKAFLDPIQTQFPWISHGDLYTLAGV
AAIQEAQGPKIPWRNGRVNKDEDEGPENGRLPDANGDATYVRSYYGRLNFLNDRDIVALM
GCHCLGRTHLANSGFDGPWGAASNVFSNEFFVNLLTENWKWEKNAAGNYQWNSPKGYMML
PADHSLIEDGTFKKIVEEYAANQDVFFKDFSNVFARLLENGITFPKDQKPFIFKTLDEQE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgctagaactttgaataaaagatcggtttatttatttggtgccgttgctggt
gcagctgcagctgcctccatggcatctcaatctgaattttctaaattcagttacaataac
agcaataacaacaacaacaacaaccgtcataacaactttagtagattcactaaggctggt
ttattcggtattggtgctgcttctgcttcccatccaaatgtcgctaatcctgataagact
aagactatcgaagattatcaaaaaatttacaatgtcattgcaaagaagattcaagacgaa
gatgaacacgatggctacatcggttacattccaatcttggtcagaattgcttggcattct
tccggtacttatgataaggagtccggtaccggtggttctcacggtggtaccatgagacat
gcaaaagaattgaatgacccttctaatgcaggtttacatactgctaaggcattcttagac
ccgattcaaactcaattcccatggatctcccatggtgatttatacaccttggctggtgtc
gctgctattcaagaagcccaaggtccaaagattccttggagaaacggaagagtcaacaag
gacgaagatgaaggtccagaaaacggtagattaccggacgctaatggtgatgctacttat
gtcagatcctactacggcagattgaatttcttgaacgatagagatatagttgctctaatg
ggttgccactgtcttggtagaactcatttagccaactctggtttcgatggtccatggggc
gctgcctccaatgtcttttccaatgaattcttcgtcaatttattaactgaaaattggaaa
tgggaaaagaatgctgctggtaactaccaatggaattctccaaagggttacatgatgtta
ccagctgaccattctttaattgaagatggtacatttaagaagattgttgaagaatatgct
gctaaccaagacgttttcttcaaagattttagtaacgttttcgctagattattggaaaat
ggtattactttcccaaaggatcaaaaaccattcatctttaagaccttagacgaacaagaa
taa

DBGET integrated database retrieval system