KEGG   Tetrapisispora phaffii: TPHA_0E03300Help
Entry
TPHA_0E03300      CDS       T02235                                 

Gene name
TPHA0E03300
Definition
(RefSeq) hypothetical protein
Organism
tpf  Tetrapisispora phaffii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:703575..704912
Genome map
AA seq 445 aa AA seqDB search
MYIDPQNKNEVRRLSVSPRLEESEQPLYRSKNSQLDLDNNRPGQQQDKNNSEEDVRKQQG
NIEDSIDKLNKKMSNAKLDDIEQRIRNGPDGGEVGDQLKLAGISKQRTVANEENDLKKLA
VHGKKTDCKYTLRDFQILRTLGTGSFGRVHLVRSNHNDRFYALKVLKKYTVVKLKQVEHT
NDERKMLSVVAHPFLIRMWGTFQDCEQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA
EVCLALEYLHSMDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPE
VVSTKPYNKSVDWWSFGILIYEMLAGYTAFYDSTTMKTYENILNAPLKFPPFFHPDVQDL
LSKLINRDLSKRLGNLQGGSEDVKNHPWFSEVIWEKLLSRNIETPYEPPIQQGKGDTSQF
ERYPEEEINYGIQGEDPYNVLFEGF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtatattgaccctcagaataaaaacgaggtcaggaggttaagtgtgtctccaagactt
gaggaatccgaacaaccgctttataggagcaagaacagtcaactggacttggataataat
agaccaggtcaacaacaagataaaaataatagtgaagaagacgttaggaagcagcagggt
aatattgaggatagcatagataaactgaataaaaagatgtcgaatgcaaagttggatgac
atagaacaaaggatacgaaatggaccagatggaggagaggtgggcgaccaattgaaattg
gctggtatttccaaacaaaggaccgttgcaaacgaagagaatgatttaaaaaagttagct
gttcatggtaaaaaaacagattgcaaatatactctaagagatttccaaattctgagaacg
ttaggtactggttcctttggaagagttcatctggtacgttccaaccataatgatcgcttc
tacgctttaaaagtgctgaaaaaatatacggtagtgaaattaaaacaagttgagcataca
aatgacgaaagaaaaatgttatctgtagtggctcatccattcttaatcagaatgtggggt
acttttcaagattgtgaacaagtttttatggtgatggattatattgaaggcggtgagctg
ttttcattattaaggaaatcccaaaggtttccaaaccctgtggcaaagttttatgctgca
gaagtttgtttagcattagaatatttgcatagtatggacattatctatagagatttgaaa
ccggaaaatattttattagataaaaatggtcatatcaaaattacagactttggttttgca
aagtatgttccagatgtcacatatactttatgtgggacgccggactacattgctccagag
gttgtaagtacaaaaccttataataaatctgttgattggtggagttttggcatattaatc
tacgaaatgttggcaggttacactgctttttatgattcaactacaatgaaaacttatgaa
aatattctaaacgctccattaaaatttcctccttttttccatccagatgtccaggattta
ttatccaaattgattaatagagatttgagcaaaaggttaggaaatctacaaggtggaagt
gaagatgttaaaaatcatccttggtttagcgaagtcatttgggaaaaattattatcgaga
aatatagaaacaccttacgaaccaccaattcaacaaggaaaaggtgatacgtctcagttt
gaaagatatccagaagaagaaatcaactatggtatacaaggtgaagacccctataatgta
ttgtttgaaggtttctaa

DBGET integrated database retrieval system