KEGG   Tetrapisispora phaffii: TPHA_0F00510Help
Entry
TPHA_0F00510      CDS       T02235                                 

Gene name
TPHA0F00510
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
tpf  Tetrapisispora phaffii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tpf00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(120852..121505)
Genome map
AA seq 217 aa AA seqDB search
MSNDRKALLVIDVQNDFLPPNGSLAVNGGNEIIQPILSLIEKEDWDMVIMTQDWHSMDHT
SFAQNHENVADFESVKYNSPVVGDTREQDVVVWPVHCVQNTKGSEFHTDLKSVLLDRPDI
VVLKKGYLKDREYYSAFNDIWNDHKTELNDLLQDNNIKEVYIVGIALDYCVKDTAISASQ
LGYKTTVLKDYCRAIDTSQTAMANLTENFKIHNITLT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgatcgtaaggctttgttagtcatcgatgttcaaaatgattttttaccacca
aatgggtctttggcagttaatggtggtaatgaaattattcaaccgattttgtcactgatt
gagaaggaagattgggatatggttataatgacacaggattggcattcgatggatcatact
tcttttgctcaaaaccatgagaatgttgccgattttgagagtgttaaatataactcacct
gtggtaggggacacgagggaacaagatgttgttgtttggcccgttcattgtgtgcaaaat
acaaaggggagtgaattccatacagatttgaaaagtgttcttcttgaccgtcctgatata
gttgtgttgaaaaagggttacctcaaagatagagaatattattctgcttttaatgacatt
tggaacgatcataaaaccgagttgaatgatcttttacaagataacaatatcaaagaagtc
tatatagtcggaatagcattggattattgtgttaaagacactgctatatctgcatctcaa
ttaggttacaaaaccacagttttaaaagattactgtagagcaatagatacttcacaaact
gcaatggctaacttgactgagaacttcaaaatccataacataacactgacatag

DBGET integrated database retrieval system