KEGG   Tetrapisispora phaffii: TPHA_0F00510Help
Entry
TPHA_0F00510      CDS       T02235                                 

Gene name
TPHA0F00510
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
tpf  Tetrapisispora phaffii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TPHA_0F00510 (TPHA0F00510)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TPHA_0F00510 (TPHA0F00510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(120852..121505)
Genome map
AA seq 217 aa AA seqDB search
MSNDRKALLVIDVQNDFLPPNGSLAVNGGNEIIQPILSLIEKEDWDMVIMTQDWHSMDHT
SFAQNHENVADFESVKYNSPVVGDTREQDVVVWPVHCVQNTKGSEFHTDLKSVLLDRPDI
VVLKKGYLKDREYYSAFNDIWNDHKTELNDLLQDNNIKEVYIVGIALDYCVKDTAISASQ
LGYKTTVLKDYCRAIDTSQTAMANLTENFKIHNITLT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgatcgtaaggctttgttagtcatcgatgttcaaaatgattttttaccacca
aatgggtctttggcagttaatggtggtaatgaaattattcaaccgattttgtcactgatt
gagaaggaagattgggatatggttataatgacacaggattggcattcgatggatcatact
tcttttgctcaaaaccatgagaatgttgccgattttgagagtgttaaatataactcacct
gtggtaggggacacgagggaacaagatgttgttgtttggcccgttcattgtgtgcaaaat
acaaaggggagtgaattccatacagatttgaaaagtgttcttcttgaccgtcctgatata
gttgtgttgaaaaagggttacctcaaagatagagaatattattctgcttttaatgacatt
tggaacgatcataaaaccgagttgaatgatcttttacaagataacaatatcaaagaagtc
tatatagtcggaatagcattggattattgtgttaaagacactgctatatctgcatctcaa
ttaggttacaaaaccacagttttaaaagattactgtagagcaatagatacttcacaaact
gcaatggctaacttgactgagaacttcaaaatccataacataacactgacatag

DBGET integrated database retrieval system