KEGG   Tetrapisispora phaffii: TPHA_0F01420Help
Entry
TPHA_0F01420      CDS       T02235                                 

Gene name
TPHA0F01420
Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0F01420 (TPHA0F01420)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPHA_0F01420 (TPHA0F01420)
   00020 Citrate cycle (TCA cycle)
    TPHA_0F01420 (TPHA0F01420)
   00620 Pyruvate metabolism
    TPHA_0F01420 (TPHA0F01420)
Enzymes [BR:tpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TPHA_0F01420 (TPHA0F01420)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(328481..329896)
Genome map
AA seq 471 aa AA seqDB search
MLRAVTRSTVVRNSLVRLYASKSYPSYTVINMPALSPTMTSGNLASWSKNVGDQLAVGEV
LAEVETDKATMDFEFQDDGYLAQILVPNGSKDIPVNKPIGIFVEEKKDVDAFKDFTIADI
ADAGSATATPAEKKSPESSADAAPAEKPSPAAQKTAGTDVTRIFASPLAKNIALAHGVAL
KDITGTGPRGRIVRADVEKFMSEQKSAASPAAAASTPAPAQKAAQAPSAQVSDLYKDIEI
TTMRNIIGKRLLESTQSIPSYIVSSDIAVSKLLKLRQSLNNDNTIDKTKNNYKLSINDIL
IKAISLAAKRIPDVNAYWLPQENVIRQFKNVDVSVAVATETGLITPIVKSANAKGLVSIS
TEVKDLVKRAKINKLLPAEFQGGTICISNLGMNDAVSMFTSIINPPQSTILAIGTKKRQA
IEDVGSPNGISFQDVITITGTFDHRVVDGSKAGEFMRELKKIIENPLQLLL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagcagtcacaagaagcactgtcgttagaaacagtttagttaggctatacgcc
tcgaaatcctacccaagttacacagtcattaacatgccggctttgtcccctactatgacc
tcaggcaatctggcttcttggtcaaagaacgtcggcgatcaactggctgtcggcgaggtc
ttggcagaagtggagactgacaaggctacaatggacttcgaattccaagacgatggttat
ttggctcaaatcttggttcccaatggctcaaaggatattccggtcaataagccaatcggg
atctttgtggaggagaaaaaagatgtcgacgccttcaaggacttcacaatcgcagacatc
gcagacgctggctctgccaccgcaactccagcggagaagaaatcaccagagtcatctgca
gacgctgctccagctgaaaagccttctcctgccgctcaaaagacagccggaacagatgtc
acaagaatattcgcttctcctctggcaaagaacatcgccttggcccacggggtcgctttg
aaagacattacaggtaccggtcccagaggcagaattgtcagggctgacgtcgagaagttt
atgagtgaacagaaatccgccgcttcccctgctgccgctgcttccactccggctcctgct
caaaaagctgcacaagccccatccgcacaggtctcagacctgtacaaggatatcgaaatc
actaccatgagaaatatcatcggtaagcgtctgttggaatcaactcaatcgattccttcc
tacatcgtatcctcagatatcgcagtctcaaagctgttgaaattgagacaatctttgaac
aacgataacaccattgacaagaccaagaacaactacaagctatccatcaatgatattttg
atcaaagcaatctcattggcagcaaaaagaatcccagatgtcaacgcttactggttacca
caagaaaatgttataagacagttcaaaaatgtcgacgtctccgtcgcagtggcaaccgaa
acaggtttaatcaccccaattgttaaaagtgcgaacgctaaaggtctggtctcaatttcg
accgaagttaaggatttggtgaaacgtgcaaagatcaacaaattactaccagcagaattc
caaggtggtactatttgcatctctaacttgggtatgaacgatgcagtatcgatgttcact
tccattatcaatccaccacaatcaactatcttagccattggtacaaaaaagagacaagcc
attgaagatgtcggaagtccaaatggtatttcttttcaagacgttatcaccatcactggt
actttcgaccacagagtcgtcgatgggtctaaggccggtgaattcatgcgtgaattaaag
aagatcatagaaaatccactacaattactattataa

DBGET integrated database retrieval system