KEGG   Tetrapisispora phaffii: TPHA_0F01860Help
Entry
TPHA_0F01860      CDS       T02235                                 

Gene name
TPHA0F01860
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tpf  Tetrapisispora phaffii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tpf01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tpf00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tpf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(425114..426787)
Genome map
AA seq 557 aa AA seqDB search
MVRVSLNNVKLLVDIDNKPQFHPSTTTVQTILTAECLEFIVLLHRTFNSKRKLLLSNRQL
LQKKLDSGLYQLDFLEETEYIRDDPTWKGPKSLGPGLIDRSVEITGPPLRNMLINALNAE
FVNTYMVDFEDSLSPTWQNIIYGQVNLYDLIRDNINFTSVNGKNYSLKDKIQNLPTLIVR
PRGWHMVEKHLYIDDEPISASIFDFGVFFYHNAQALIDLGKGPYFYLPKMEHHLEAKLWN
DIFNVAQDYLSIPRGTIRATVLIETLPAAFQMEEIIYQLRDHSSGLNCGRWDYIFSTIKR
LRNLPTHVLPNRDLVTMTSPFMDSYVKRLINTCHRRNVHAMGGMAAQIPIKDDKTRNDAA
MQKVRTDKIRELTNGHDGSWVAHPALAPICHEVFVNMGTKNQIHYIPDTKITSADLTNTS
IQDFQVTTEGIKQNLDIGLRYMEAWLRGSGCVPINYLMEDAATAEVSRCQLYQWVKHGVT
LSDTGEVVTPELTTKILTEQVSRLKQSSPVGDKNKFDTAAKYFLPEITAKHFSEFLTTLL
YDEIVTQKSAPTHLSKL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtaagagtatctttaaataacgttaaattattagtggacattgataataaaccacag
tttcacccttcaactactactgtgcagactattttaactgcagaatgtttggagttcatt
gtcctattacatagaacttttaattccaagagaaaattactattgtcaaatagacagcta
ttacaaaaaaaattggactcaggtctttatcaattagattttttagaggaaacagagtat
attagagatgatccaacttggaaaggtccgaaatctttaggtccaggcttgatagataga
tccgttgaaattactggtcctccattaagaaatatgttaattaacgctttgaatgcagaa
tttgttaatacttatatggtagattttgaagattcattatcaccaacttggcagaatatc
atttatggacaagtaaacttgtatgatttaattagagataatattaattttacttctgtt
aatggaaaaaattatagtttgaaagataaaattcaaaatttaccaacattaatagtgaga
ccaagaggttggcatatggttgaaaaacatctatacatcgatgatgaaccaatctctgct
tcaatcttcgactttggtgttttcttctatcacaatgcacaggctttgattgacttgggg
aaaggtccatatttctatttaccaaaaatggaacatcatttggaggcaaaattatggaat
gacatctttaatgtcgcacaggattatttatctattccaagaggaacaatcagagccact
gtattgatcgaaactttacctgcagctttccaaatggaagaaataatttatcaattaaga
gatcattcctcaggattgaattgtggtcgttgggactatatattctcaacaataaaaagg
ttacgaaacttacctactcatgttttacctaatagagatttagtgacaatgacctctcca
ttcatggattcgtatgttaaaaggttgatcaatacatgccacagacgtaatgttcatgca
atggggggtatggctgctcagattccaattaaggatgacaaaacaagaaatgacgcagca
atgcaaaaagttagaactgataaaatcagagaattgactaatggacatgacggctcatgg
gtagcacatccggctttggcaccgatctgtcatgaagtgtttgtaaacatgggaactaaa
aaccaaattcattacattccagatacaaagatcacctcagcagatttaacaaacacaagt
atccaagattttcaagtaacaactgaaggtatcaaacaaaaccttgatattgggttaaga
tacatggaggcttggctaagaggttctggctgtgtcccaattaactatttaatggaagat
gcagcaacagcagaagtctcacgttgccaattataccaatgggttaagcacggtgttact
ttaagtgacacgggtgaagtcgttacccccgaattaacaacaaagattttaacggagcag
gttagtagattgaaacaatctagtccagttggtgacaaaaataagtttgacacagctgca
aaatacttcttacctgaaataacagctaaacatttcagtgagtttttaaccactttgtta
tatgatgagatcgtaacgcaaaaatcagctccaacccatttaagtaaattataa

DBGET integrated database retrieval system