KEGG   Tetrapisispora phaffii: TPHA_0F02490Help
Entry
TPHA_0F02490      CDS       T02235                                 

Gene name
TPHA0F02490
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tpf  Tetrapisispora phaffii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TPHA_0F02490 (TPHA0F02490)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     TPHA_0F02490 (TPHA0F02490)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:549495..551528
Genome map
AA seq 677 aa AA seqDB search
MVKLNSNKHRSKKQHWPKERTYNRALLTEEGIVIKSNNINEAYSNLKRNSVSSLGPAQDS
ILRRSFSNSTSAFHNSGEFSRFNDLESTHTTDETPEKILSNADLDTLETASVVSCITCLS
DTHSITSPRTSGDLPYSFLNGKFPINTVIPFGRILHAKYIDRSLSRRGSDIKRKSPRSSL
SKTTTGNSIQSVDSGRSTINESFKDAYEFPTSPDLKTFHSNTSFNSELKDVNFNRKYAKK
LIEITFAKPRRHDIIPKRLILDIESILPLEHDLVTEILNRSYQGTRRNRKILAIINEFGG
KGNAKKLYFSKAKPILAASRCKVDIVFTEYTGHAINVAKEMDINKYDTIVCASGDGIPYE
IINGLYQRKDRAAAFSKLAITQLPCGSANAMSVSCHWTDNVSYAALSIVKSKEVQIDVVC
CSQPSYFSTSPRLSFLSQTYGLIAESDINTEFFRWIGAARFEIGVAFNILQKKKYPCELY
VKYQARNKNDLKEFYLKKHKSHQAWPNFNSYDIDPENEFTEGSSDDFQEITEENFKLKYP
YQEGIPSDWERVSPELTKNLGIFYTGKMPYIAADIKFFPAALPTDGAIDMVLTDGRTAVT
RMVPILLALDKGSHVLQPEVIHSKVLAYRIVPKGNNTLFSVDGEKFPNEPLQAEVLPRLC
KVLLRNGSFVETAFNNM
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagttaaactcaaataagcacagaagcaaaaaacagcattggcctaaggaaagg
acttataacagagctcttctaactgaagaaggcattgtcataaagtctaataatatcaat
gaggcttatagtaatttaaagaggaatagtgtatcgagtctaggtcctgctcaagatagt
atcctacgacgttctttttcaaatagcacaagtgcatttcacaatagtggtgaattctct
cgattcaatgatctagagagcacacatacgactgatgaaacccctgaaaaaatattaagc
aatgctgacttagataccttagaaaccgcgtctgtggtaagttgcattacatgtctaagt
gacactcactctataacatctccaagaacatccggcgatttaccttattcgtttttaaat
ggcaaatttccaattaacaccgtgataccattcggaagaattttgcatgcaaagtacatt
gatagatccctttctagaaggggaagtgatataaaacgtaaatctcctagatcatcgctt
tccaagactactacgggcaattccatccagtctgtagattcaggacgtagtacaatcaat
gaaagtttcaaggatgcatatgaatttccgacttctcctgatttaaagacgtttcattca
aacacttcttttaattccgaattaaaggatgtcaattttaacagaaagtatgcaaaaaaa
cttatagaaataacgtttgctaaacctcgtcgtcatgatattataccgaaaagacttatt
ttagatatagaatccattttacctttggagcatgatcttgtaacggaaattttgaataga
agctatcaaggcacacgtagaaatagaaagattttagccattataaacgaatttggtggg
aaagggaatgccaagaaattatatttttcgaaagcaaaaccaatattagcagcaagtaga
tgtaaggttgatatagtatttactgaatatactggtcatgctattaacgttgcaaaagaa
atggatataaataaatatgacactatagtatgtgcgtcaggagatggtattccttatgaa
attattaatgggttatatcaaagaaaggacagagctgctgcatttagtaaacttgccatt
actcaacttccctgtggttctgccaatgctatgagcgtatcttgtcattggactgataat
gtctcatatgctgcattgtcaattgtcaaatcaaaagaagtacaaattgatgtagtatgt
tgttctcaaccatcctatttttccacatcccctcgtctatcatttctaagccaaacgtat
ggattaattgcagaatcagatatcaatactgaattttttagatggataggggctgcgagg
tttgagatcggtgtcgcattcaatattttacagaagaagaagtatccctgtgaattatat
gtcaaataccaagccagaaataaaaatgatttaaaagaattttatttgaaaaaacacaaa
tcccatcaagcatggcctaatttcaattcatatgatatagatccggaaaatgaatttacc
gaaggatcaagtgatgatttccaagaaataacagaagaaaacttcaaactaaagtatcca
taccaggagggaattcctagtgattgggaaagggttagtccagagttaacaaaaaactta
ggtatattttacactgggaaaatgccttacattgctgctgatattaagtttttcccagca
gcattaccgactgatggagcaatcgacatggttctaaccgatggtagaacagcagttaca
agaatggtaccaatattattggcattagacaaaggttcgcatgttttacaacctgaggtt
atacactcgaaagtattagcatatagaatagtccccaaaggaaataacacattattttcg
gttgatggtgagaagtttcctaatgaaccattacaagcagaagtcctaccacgattatgt
aaagttttgttaagaaacggttcgtttgtagagactgctttcaacaatatgtaa

DBGET integrated database retrieval system