KEGG   Tetrapisispora phaffii: TPHA_0F02490Help
Entry
TPHA_0F02490      CDS       T02235                                 

Gene name
TPHA0F02490
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tpf  Tetrapisispora phaffii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:549495..551528
Genome map
AA seq 677 aa AA seqDB search
MVKLNSNKHRSKKQHWPKERTYNRALLTEEGIVIKSNNINEAYSNLKRNSVSSLGPAQDS
ILRRSFSNSTSAFHNSGEFSRFNDLESTHTTDETPEKILSNADLDTLETASVVSCITCLS
DTHSITSPRTSGDLPYSFLNGKFPINTVIPFGRILHAKYIDRSLSRRGSDIKRKSPRSSL
SKTTTGNSIQSVDSGRSTINESFKDAYEFPTSPDLKTFHSNTSFNSELKDVNFNRKYAKK
LIEITFAKPRRHDIIPKRLILDIESILPLEHDLVTEILNRSYQGTRRNRKILAIINEFGG
KGNAKKLYFSKAKPILAASRCKVDIVFTEYTGHAINVAKEMDINKYDTIVCASGDGIPYE
IINGLYQRKDRAAAFSKLAITQLPCGSANAMSVSCHWTDNVSYAALSIVKSKEVQIDVVC
CSQPSYFSTSPRLSFLSQTYGLIAESDINTEFFRWIGAARFEIGVAFNILQKKKYPCELY
VKYQARNKNDLKEFYLKKHKSHQAWPNFNSYDIDPENEFTEGSSDDFQEITEENFKLKYP
YQEGIPSDWERVSPELTKNLGIFYTGKMPYIAADIKFFPAALPTDGAIDMVLTDGRTAVT
RMVPILLALDKGSHVLQPEVIHSKVLAYRIVPKGNNTLFSVDGEKFPNEPLQAEVLPRLC
KVLLRNGSFVETAFNNM
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagttaaactcaaataagcacagaagcaaaaaacagcattggcctaaggaaagg
acttataacagagctcttctaactgaagaaggcattgtcataaagtctaataatatcaat
gaggcttatagtaatttaaagaggaatagtgtatcgagtctaggtcctgctcaagatagt
atcctacgacgttctttttcaaatagcacaagtgcatttcacaatagtggtgaattctct
cgattcaatgatctagagagcacacatacgactgatgaaacccctgaaaaaatattaagc
aatgctgacttagataccttagaaaccgcgtctgtggtaagttgcattacatgtctaagt
gacactcactctataacatctccaagaacatccggcgatttaccttattcgtttttaaat
ggcaaatttccaattaacaccgtgataccattcggaagaattttgcatgcaaagtacatt
gatagatccctttctagaaggggaagtgatataaaacgtaaatctcctagatcatcgctt
tccaagactactacgggcaattccatccagtctgtagattcaggacgtagtacaatcaat
gaaagtttcaaggatgcatatgaatttccgacttctcctgatttaaagacgtttcattca
aacacttcttttaattccgaattaaaggatgtcaattttaacagaaagtatgcaaaaaaa
cttatagaaataacgtttgctaaacctcgtcgtcatgatattataccgaaaagacttatt
ttagatatagaatccattttacctttggagcatgatcttgtaacggaaattttgaataga
agctatcaaggcacacgtagaaatagaaagattttagccattataaacgaatttggtggg
aaagggaatgccaagaaattatatttttcgaaagcaaaaccaatattagcagcaagtaga
tgtaaggttgatatagtatttactgaatatactggtcatgctattaacgttgcaaaagaa
atggatataaataaatatgacactatagtatgtgcgtcaggagatggtattccttatgaa
attattaatgggttatatcaaagaaaggacagagctgctgcatttagtaaacttgccatt
actcaacttccctgtggttctgccaatgctatgagcgtatcttgtcattggactgataat
gtctcatatgctgcattgtcaattgtcaaatcaaaagaagtacaaattgatgtagtatgt
tgttctcaaccatcctatttttccacatcccctcgtctatcatttctaagccaaacgtat
ggattaattgcagaatcagatatcaatactgaattttttagatggataggggctgcgagg
tttgagatcggtgtcgcattcaatattttacagaagaagaagtatccctgtgaattatat
gtcaaataccaagccagaaataaaaatgatttaaaagaattttatttgaaaaaacacaaa
tcccatcaagcatggcctaatttcaattcatatgatatagatccggaaaatgaatttacc
gaaggatcaagtgatgatttccaagaaataacagaagaaaacttcaaactaaagtatcca
taccaggagggaattcctagtgattgggaaagggttagtccagagttaacaaaaaactta
ggtatattttacactgggaaaatgccttacattgctgctgatattaagtttttcccagca
gcattaccgactgatggagcaatcgacatggttctaaccgatggtagaacagcagttaca
agaatggtaccaatattattggcattagacaaaggttcgcatgttttacaacctgaggtt
atacactcgaaagtattagcatatagaatagtccccaaaggaaataacacattattttcg
gttgatggtgagaagtttcctaatgaaccattacaagcagaagtcctaccacgattatgt
aaagttttgttaagaaacggttcgtttgtagagactgctttcaacaatatgtaa

DBGET integrated database retrieval system