KEGG   Tetrapisispora phaffii: TPHA_0F02870Help
Entry
TPHA_0F02870      CDS       T02235                                 

Gene name
TPHA0F02870
Definition
hypothetical protein
Organism
tpf  Tetrapisispora phaffii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(636574..638259)
Genome map
AA seq 561 aa AA seqDB search
MHSRFQKNTLERRNAKQLMLSDEISTTDDNKNNIFKYGGSDLSLRRNFKKKLTLNQKGSE
NDSHSMDDGNHAGNDDNIDDREDENANENLLMEFSQTNNKLFSRGNPLHHSQDSLLKTTQ
IKDNCIQINNSNLHDYSKTTSEESLNYLLSTQRKSVISSSSTATSEMSPVSSMHSKLKGL
TPDGEEAMFTEKDKNSLSCNTSYQIDPQNLVQLGKIGSGNSGTVTKALHVPNSTIIAKKV
IPVEMNNEAVIKQIMRELTIMKSVKTHPNIVEFFGAFTNHHDNNELVILLEYMNCGSLDQ
IIKINKSMQVLDETQNNPHLGMVTWFNELSISVISYSVLTALDYLYSNYKIIHRDIKPSN
VLINSQGQVKICDFGVSRKMVNSIVDTFVGTSTYMSPERIQGNVYSTKGDVWSLGLMIIE
LITGEFPLNNDGVDNSSPDGILDLLQRIVNEPSPKLPTASDKDQTTSAYSVEITDFVNRC
CIKSEKERSPINELLCHDFIVKYNTNSNSTHHNINREFRRWCKDIKTEIKKHKQMRREEI
ERVKYEKKQLERSAEAALARR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaggtttcagaaaaatacattggagagacgtaatgcgaaacagttgatgtta
tcggatgaaatctcaactactgatgataataagaacaatatttttaaatatggaggatct
gacttatctctacgaaggaactttaaaaagaaactgactttgaatcagaaaggtagtgaa
aatgatagccattcaatggatgatggtaatcatgctggaaatgatgacaatatagatgac
agagaggatgaaaatgctaatgaaaaccttttaatggaatttagtcaaacaaataataaa
ttattctctagaggtaatccattgcatcattcgcaagattctttattgaaaactactcaa
ataaaggacaattgcatacaaataaataactcgaatttacatgactattctaaaacaaca
tccgaagagagtctgaattatctgttgagcactcagaggaagagtgtaatatcaagcagc
agtacggcaacgagtgaaatgtcaccggtctcttcaatgcattcaaaattaaaaggtctt
acaccagacggtgaagaagcaatgttcactgagaaagataaaaattctctaagttgcaat
acttcttatcaaattgacccacaaaatttagttcaattgggtaaaattggttcaggtaat
tccggaactgtcacaaaggctcttcatgtacccaattcgacaattatcgccaaaaaagtg
attcctgtagaaatgaataatgaagctgtcataaagcaaatcatgagagagttaactata
atgaaaagtgttaagactcatccaaatattgtagaattttttggtgcgtttaccaaccat
catgataataatgagttagtaatactattagagtatatgaactgtgggtcactggatcaa
ataataaaaattaataaaagcatgcaagtattagatgaaactcaaaacaatccacattta
ggcatggtaacatggttcaatgaattatctatttcagtgatctcgtactccgtattaaca
gcattagattatctatactctaattacaaaattattcacagggatattaagccttcgaat
gtgttgataaatagtcaaggtcaagttaaaatatgtgactttggtgtctcgcgtaaaatg
gtgaactctattgttgatacatttgtaggtacatccacatatatgtcaccagagagaata
caaggtaatgtttactctacaaaaggtgatgtgtggtcgttgggtttaatgattattgaa
ctaataacaggtgaatttcctttaaataatgacggagttgacaatagttcgcctgatggt
atattggatcttttacaaaggattgttaatgaaccttctcctaaactgcctacagcaagc
gataaagatcagacaacttcagcatattctgttgaaataacagattttgtgaataggtgt
tgcataaaaagtgagaaggagagatcccctataaatgaacttctatgtcatgatttcata
gtaaaatataataccaatagtaactcaacgcatcataatataaatagagaattcagaagg
tggtgtaaggacatcaagacggaaatcaaaaagcataaacagatgagaagagaagagatt
gaaagagtcaaatatgaaaagaaacaactggagagatctgcagaagctgcattggcaaga
agatga

DBGET integrated database retrieval system