KEGG   Tetrapisispora phaffii: TPHA_0F03330Help
Entry
TPHA_0F03330      CDS       T02235                                 

Gene name
TPHA0F03330
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
tpf  Tetrapisispora phaffii
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tpf00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:718502..718828
Genome map
AA seq 108 aa AA seqDB search
MAYEKGSEKKGATLFKTRCLQCHTVEEGGPNKVGPNLHGIFGRHSGQAPGFSYTDANIKK
NVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLVKATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaaaaaggttccgaaaagaaaggtgctactctgttcaaaaccagatgtcta
caatgtcacaccgttgaggaaggtggtccaaacaaggttggtccaaatttgcacggtatc
ttcggtagacactctggtcaagctccaggtttctcctacaccgatgcaaacatcaagaaa
aatgtcttatgggatgagaataacatgtctgaatacttaactaatccaaagaaatacatt
ccaggtacaaagatggctttcggtggtttgaagaaggaaaaggacagaaacgatttaatc
acttacttagttaaggcaactaaatag

DBGET integrated database retrieval system