KEGG   Tetrapisispora phaffii: TPHA_0F03330Help
Entry
TPHA_0F03330      CDS       T02235                                 

Gene name
TPHA0F03330
Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00920  Sulfur metabolism
tpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TPHA_0F03330 (TPHA0F03330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 11535646
NCBI-ProteinID: XP_003686248
UniProt: G8BUM8
Position
6:718502..718828
Genome map
AA seq 108 aa AA seqDB search
MAYEKGSEKKGATLFKTRCLQCHTVEEGGPNKVGPNLHGIFGRHSGQAPGFSYTDANIKK
NVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLVKATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaaaaaggttccgaaaagaaaggtgctactctgttcaaaaccagatgtcta
caatgtcacaccgttgaggaaggtggtccaaacaaggttggtccaaatttgcacggtatc
ttcggtagacactctggtcaagctccaggtttctcctacaccgatgcaaacatcaagaaa
aatgtcttatgggatgagaataacatgtctgaatacttaactaatccaaagaaatacatt
ccaggtacaaagatggctttcggtggtttgaagaaggaaaaggacagaaacgatttaatc
acttacttagttaaggcaactaaatag

DBGET integrated database retrieval system