KEGG   Tetrapisispora phaffii: TPHA_0F03570Help
Entry
TPHA_0F03570      CDS       T02235                                 

Gene name
TPHA0F03570
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tpf  Tetrapisispora phaffii
Brite
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   TPHA_0F03570 (TPHA0F03570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:768648..776030
Genome map
AA seq 2460 aa AA seqDB search
MLQLRRNVEARKAKKKLGSNRDSGNMSSSSTQNGVQSSAGNESTLDITTGPDGKVFVDND
HSMVDLETNFGTINIIFDKLKSPSAQERTQASLELKASLISVAREISTEQFQRFSNILNN
KIFELIHGSDLNEKMGGILAVDTLIDFYVHTEELPNQTSRLANYLRVLIPSNDTEVMRAA
ATTLGKLAIPGGTLTSDFVEFEVKTCIEWLTTSPGNNSSSSKQEHRKHAALLIVTALANN
SPYLLYPYVNSILDNIWRALRDSKLVIRLDAAITLGKCLSIIQNRDSTLTKQWYERLFKG
CIYGLSLSSNDATHATLLVYRELLALRGSYLNGKYDEIYYSTIKYKEHKSDVIRNEVYAI
IPLLASFNPHQFTTKYLDQIMIYYLMVLKNLNASSTNIADKPFILISIGNIASEVAGSIT
PFLDAILGNIRDGLKTKYKNRKTFERGLFYCISKLASAVRGALAKHLNKDILDLILACQL
SDYMQDTLMTLNKMIPALQPTINERLLNLLCIYLSGEEFQQPGSPNVQKSFSLATARDWR
DKTIFKKTGEINDDDNDARILTQTFRMLQTIVHKYSLTEFVQIVTISYIEHQNPFVRKLA
ALTSCDLFVKEDICELTSLHALNSVSEVLSKLLALAITDPVADIRFEILQHLNSKFDPHL
AQPDNIRLLFMALNDEVFVIQMEALKIIGRLTSVNPAYIIPSLRKTLLELLTQLKYSVKP
RKNEESATLLCTLISSSKEVTKAYIEPILDVLLPKSQDSSSVVASTALKTVGELSVVGGE
EMKQYLDDLMPMIINTFQDQSNSFKRDAALKTLGQLASSSGYVIEPLLEYPELLGVLISI
LKSESSLNIRRETVRLIGILGALDPYKHREVEVTLNTKISVEQNAPSIDIALLMQGMSPS
NEEYYPTVVINTVLKILRDPSLSTHHTAVIQAIMHIFQVLGLRCVSFLSQIVPAIINIMH
TCPPSLLEFYFQQLGLLINVVKQHIRPHVNEIYGVIQKFIPIIKLQIPIIAVIEVISKSM
EGEFKKFVPQTLTFFINILENDKSPKKAVSIRILKSIVVFNSNIEDFSHLIIPTIVRMSE
FSHGNLKKMSIVTIGKLAKSINISEMSSRIVQTLVRILNNGDNELTKCIMNTLSLLLLQL
GTDFTVFIPVINKSLIRNHIQHSIYDQLVNQLLNNEGLPTNIVFDKEYDTPSKDVAEIES
PPAKLPVNKQVLQNAWDCSQQRTREDWQEWIRRLSIQLLKESPSHALRACSNLAGIYNPL
ARDLFNASFSSVWTELYSQYQEDLVNSLCTALSSPHNPPEIHQTLLNLVEFMEHDDKSLP
IPIQVLGKYAQKCHAYAKALHYKEVEFIQEPSTSTIESLISINNQLHQTDAAIGILKHAQ
QHHDLQLKETWYEKLQRWDDALKAYTKREEEGEDSLEVMMGKMRSLHALGAWEKLSTLAE
SKWSGSKLDVKKIMAPLAAGAAWGLGEWERIEQYINVMKPQSPDKEFFDAVLAVHKSNFN
EAEKHIFNARDLLVTEISALINESYDRAYGVVVRAQIIAELEEIIKYKKLPPDSENAIVI
RNTWNKRLLGCQKNVDVWQRVLRVRSLVVKPKQDKQIWIKFANLCRKSGRMGLARKALNS
LLEDGGDPDHPNTARAPPPVIYAQLKYLWSTGSQKDTLLHLIGFTSRMAHDLGLDPNNMI
AQNVMKSSTIAPEHVDEYTKLLARCFLKQGEWRVQLQPNWRVENPDAILGSYLLATHFDN
KWYKAWHNWALANFEVISMISSSSLEKVNVSSEASTNMMYKIENNSKESDIKDIQKEAFP
AELIQRHVVPAIKGFFHSISLSESSSLQDTLRLLTLWFTFGGIPEATQAMHEGFRLIKID
NWLEVLPQLLSRIHQPNQVVSRSLLSLLSDLGKAHPQALIYPLTVAIKAESISRQKAALS
IIEKMRMHSPTLVDQAELVSGELIRVTVLWYELWYEGLEDASRQFFGEHNTEKMFATLEP
LHEMLRRGPETLREISFQNSFGRDLNDAYEWVMNYKRSKDISNLNQAWDIYYNIFRRISR
QLPQLQVLELQHVSPKLLAARDLELAVPGTYQAGEPLVRISRFDPVLTVISSKQRPRKVT
IKGSDGKDYLYALKGHEDIRQDKLVMQLFGLVNTLLQHDPDCFQRHLDIQKFPVIPLSPR
SGLIGWVSNSDTLHVLIREHREAKKVPLNIEHWVMLQMAPDYDSLTLLQKVEVFTYALDN
TRGQDLYKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLLLDRITGKV
VHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGVEGSFRITCESVMRVLRANKDS
LMAILEAFVYDPLIHWGFDLPTQTIMESTGIEFPILNPSELLRKGAITAEEASKMELEQK
TQIRNARSMLVLKRITDKLAGNDIPRFTELDVPEQVDKLIQQATSVENLCQHYIGWCPFW
NT seq 7383 nt NT seq  +upstreamnt  +downstreamnt
atgttacagttaagaagaaatgttgaagcaagaaaagctaagaaaaaactaggttccaat
agagattcgggaaatatgtctagctcatcaactcagaatggagttcaatcttcagctggg
aatgaatctacattagatattacaacgggaccagatggtaaagtttttgtggacaatgat
cattcaatggttgatctagaaaccaattttggaacaatcaatataatatttgataaatta
aagagtccgtccgcacaagaaaggacacaggcttctcttgagctgaaggcatcgttgatt
tctgttgccagagagatatcaacagaacaatttcaaaggttcagcaacattttaaataat
aaaatattcgagcttattcatggttcagatttgaacgaaaaaatgggaggcatcttagct
gttgatacattaattgatttttacgtgcacaccgaggaattacctaaccaaacatcaaga
ttagcaaattatcttcgtgtattgatcccatcaaacgatacagaagtgatgagagctgct
gctacaaccttaggtaaattagccatacctggtggaacattaacatctgacttcgttgaa
tttgaggttaaaacttgcattgaatggttgacaacatcaccaggtaacaattcttcaagc
tcaaaacaagaacatagaaaacatgctgcattgttgattgtgacagcattagcaaacaat
tcaccatatttattatacccctatgttaattcaattttggataatatatggagagcttta
agagattctaaattagttataaggctagatgcagcaatcacattaggtaaatgtttatct
attattcagaatagggattcgacattaacaaagcaatggtatgaaagactgtttaaagga
tgtatatatggtttaagcttaagttcaaatgatgctacccatgcaacgttacttgtatat
agagaattattggctttgcgaggttcctatttaaatgggaaatatgacgaaatatattat
tcaacgatcaaatataaagaacataaatcagatgtgattagaaacgaagtgtatgcgatt
attccactgttggcttcttttaatccacatcaatttaccacgaaatatttagaccaaatt
atgatatactacttgatggttttaaaaaatttaaatgcaagtagtacaaatatagctgat
aaaccgtttatattaatatctatcggtaatattgcatcagaagttgctggcagtattaca
ccatttttagacgcaattttgggtaatataagggatggattaaaaaccaaatacaagaat
cgtaaaacttttgaaagaggactattttattgtataagtaagttagcatctgctgtcagg
ggagcattggcaaagcatttgaataaagatatcttagacttaattttagcatgtcaatta
tccgattatatgcaagacacactaatgacattaaataaaatgatccccgctttacagccc
actatcaatgaaagattattaaatctgttatgtatatatctatcaggagaagaatttcaa
caacctggttctcccaatgttcaaaagtcattttcattagcgacagctcgtgattggaga
gataaaacaatttttaaaaagactggggaaatcaatgacgatgacaatgacgcaagaatt
ttaacacagacgtttcgtatgctacagactattgtacacaaatattcattaacagagttt
gtccaaattgttactatttcatatattgagcatcaaaatccatttgtgagaaaacttgct
gccttaacatcgtgtgatttgtttgtaaaagaggatatctgtgaactcacttcattacat
gccttaaattctgtttcagaagttttaagcaaattattagcacttgccattaccgatcca
gttgcagatattagatttgaaattcttcaacatttaaactctaaatttgatcctcacttg
gcacaacctgataatatcagattattatttatggctttgaatgatgaagtctttgtcatt
cagatggaagctttgaaaatcattggtcgtttaacgtcagtgaatcctgcatatatcata
ccatctttaagaaagacattgttagaacttctaactcagttaaagtattctgttaagcca
agaaaaaatgaagagagtgctacattgttatgcacacttatcagctcaagtaaggaagtc
acgaaagcatacattgaacctattcttgatgttttgttgccaaaatcacaagatagttcc
tcagttgtagcatctactgctctgaaaactgttggtgagttatcagttgttggtggagaa
gaaatgaaacaatatctagatgatttaatgccgatgattattaatacgtttcaagaccaa
tcaaactcattcaaaagagatgctgcactaaaaacattaggtcaattggcgtcttcatcc
ggttatgtcatagagccgttactggaatatcctgaactgttaggtgtacttattagcatc
ttgaagtccgagagttcattaaatatcagaagagagactgtccgtctaattggtatttta
ggtgctcttgatccttacaaacacagagaagtggaagtgacattgaatacaaagataagt
gttgaacaaaacgccccttcgattgacattgctttgctaatgcaaggtatgtctccatca
aatgaagaatattatcctactgttgtgattaacaccgtgttgaaaattctccgtgatcca
tctttatctactcaccatactgcagttatacaagcaataatgcacatatttcaggtatta
gggttacgctgtgtttcgtttcttagtcaaatagttccagcgataattaatataatgcac
acatgtccaccttcgttattagagttttactttcaacaattaggtttactaataaatgtt
gttaagcagcatattagaccacatgtaaatgaaatatatggggtgatccagaaattcatt
cctattataaaacttcaaattcctataattgctgttattgaagttatatctaaatcgatg
gaaggggagtttaagaagtttgtcccacaaactttaactttttttataaatattcttgag
aatgataaatcccctaagaaagctgtatcgataagaattttgaagtcaatagtggtattt
aattctaacattgaagatttttcacatttaattattccaactatagttagaatgtcagaa
ttttcacatggaaatttgaaaaagatgtctattgtcactataggtaagttagcaaaatct
attaacatttcagagatgtcatccagaatcgtacagacattagtcaggatattaaataat
ggtgataatgaactaacaaaatgtataatgaatactttgagtttattattattacaatta
ggtactgattttactgtgtttattcccgtgattaacaaatcattaataagaaatcatatc
caacacagtatttatgaccagttagttaatcaattattaaataatgaaggtctaccaact
aatattgtgtttgataaggaatatgatacaccatcaaaggatgttgctgaaattgaatct
cctcctgcaaagttgcctgtcaacaagcaggttttgcaaaatgcatgggactgtagtcaa
caaagaactagagaagattggcaagaatggataagaagattatcgatacaactattgaaa
gaatcaccttcgcatgcacttcgtgcttgttctaatttggcaggtatctataatcctttg
gctagagatttatttaacgcttcattctcaagtgtatggaccgaactgtattcacaatat
caagaagacttggttaattccttgtgcactgctctatcatctcctcataatccacctgaa
atacatcaaacgcttttaaatttagttgaattcatggaacatgatgataagtcattacca
attcctattcaagttcttggtaaatatgctcaaaaatgccacgcgtatgctaaagcttta
cactataaggaagttgaatttatacaagaacccagtacctctactattgaatcactaatt
agcatcaataatcaattacatcagactgatgctgccattggtatattaaagcatgcccaa
caacaccacgatctgcaattaaaagaaacttggtatgaaaaacttcaacgttgggatgat
gcattgaaagcatatacgaagcgtgaagaagaaggtgaagattcgcttgaagtcatgatg
ggtaaaatgagatcactacatgcacttggagcttgggagaaattatccacccttgctgaa
agtaaatggtcaggatctaaactagatgtcaaaaaaatcatggctccacttgctgctggt
gctgcatggggtcttggtgaatgggagaggattgaacaatatatcaatgtaatgaagcct
cagtctcctgataaagaattttttgatgcagttttagctgttcataaaagtaacttcaat
gaggctgaaaaacacatttttaatgctagagacttactagtcactgaaatttctgctttg
ataaatgaaagttatgacagagcttatggtgttgtcgtaagagcccaaataatagccgag
ttagaagaaattattaaatataagaagttaccacctgattctgaaaatgccattgttata
aggaacacatggaataaaaggttactaggttgtcagaaaaatgtagatgtttggcaacgt
gtcttaagagtgcgttctctggtagttaagccaaaacaagataaacaaatatggattaag
tttgcaaatttatgccgcaaatctggtagaatgggtttggctagaaaagctttgaattct
ttgctagaagatggaggtgatccggaccatccaaatactgcaagggcaccaccccctgtc
atttatgctcaattgaagtatctatggtccactgggtctcaaaaggatacattattgcat
ttgattggatttacatcaagaatggcccacgatttgggtttagatccaaataatatgata
gcacaaaatgttatgaaaagcagcacaattgcacctgagcatgttgatgaatatacaaaa
ttattagctagatgtttcctaaaacagggtgaatggagagttcaattgcaaccaaattgg
agagttgaaaatccggacgctattttgggctcatacttattggcaacacattttgataac
aagtggtacaaagcatggcataattgggctttagctaattttgaagtgatctctatgatt
tcgtcaagttcattagaaaaagtaaacgtgtcatctgaagcatctactaatatgatgtat
aaaattgagaataattccaaggaatcagatataaaagatattcagaaagaagcctttcca
gcggagctcattcaaagacacgttgttccggccattaagggttttttccattcaatttct
ttatcagaatccagttcattgcaagatacattgagactattaacattatggtttacattt
ggtggtattccagaagctacacaggcgatgcatgaaggtttcagattaattaaaatagat
aattggctggaagttcttccacaactgctttctcgtattcatcaacctaatcaagtagtc
agcagatcattattgtcattattatctgatttaggtaaggcacatcctcaagcacttatc
tatccgttaactgttgccattaaagctgaatctatttcgagacagaaggcagctttatca
attattgaaaagatgcgcatgcacagccctacactagttgatcaagcggagttagtcagc
ggtgaattaattagagttacagtactttggtatgaattatggtatgaaggtttagaggac
gctagtagacaattttttggtgaacataatactgaaaaaatgtttgctactttagaacca
cttcatgaaatgttaagaagaggaccagaaactttacgtgaaatatctttccaaaattcg
tttggtagggacttaaatgatgcatatgagtgggtgatgaattataagagaagtaaggac
attagtaatttaaatcaagcttgggatatctattataacatttttagaagaattagcaga
caattaccacaattgcaagttttggaattacaacacgtgtctccgaagttactagctgct
cgtgatttagaactagccgtacctggtacttaccaagccggtgaacctttagttagaatt
tctagatttgatccagtattaacagttatttcttctaaacaaaggccacgtaaagttact
attaaaggtagcgatggtaaagattacttatatgctctgaagggtcacgaagatatcaga
caagataaactagttatgcaattgtttggtttggtgaacaccttactacagcatgaccca
gactgcttccaaagacatttagatatccaaaaattcccagtcatcccattatctccaaga
tctgggttaattggatgggtttcaaacagtgacacattgcatgtgttgatacgtgaacat
agagaagctaagaaagttccacttaatatagagcattgggtcatgttgcaaatggcacca
gattatgacagcttaaccttattacaaaaggtagaagtttttacatatgctttggataac
actagaggtcaagatttatataaggttttatggttgaagagtcgatcatctgaatcttgg
ttagaaagaagaactacatatacaagatcattggccgtcatgtctatggtcggctatata
ttaggtttaggagatcgtcatccaagtaatttgttattagacaggataactggtaaggtc
gttcacatcgattttggcgattgttttgaagcagcaatattaagagaaaagtatcccgaa
aaagttccattcagattaacgaggatgttaacatatgcgatggaagttagtggtgttgaa
ggtagtttccgtataacgtgtgaaagtgttatgagagttttaagagcaaataaagattct
ctgatggcaatattggaagcttttgtgtacgatccattgattcattgggggtttgatcta
cccactcagacaattatggaaagtacaggtattgaatttcctattttaaacccaagtgaa
ttgttgagaaaaggtgctattaccgctgaagaagcctcaaaaatggaacttgaacagaaa
acgcaaattagaaatgcacgttcaatgttagtacttaaaagaataacagataaattggca
ggcaatgatatacctagatttacagaattggatgttcctgagcaagttgacaaattaatt
caacaagcaacatctgttgaaaatttatgtcaacattatattggttggtgtccattctgg
taa

DBGET integrated database retrieval system