KEGG   Tetrapisispora phaffii: TPHA_0G00520Help
Entry
TPHA_0G00520      CDS       T02235                                 

Gene name
TPHA0G00520
Definition
(RefSeq) hypothetical protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TPHA_0G00520 (TPHA0G00520)
Enzymes [BR:tpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TPHA_0G00520 (TPHA0G00520)
Chaperones and folding catalysts [BR:tpf03110]
 Protein folding catalysts
  Protein disulfide isomerase
   TPHA_0G00520 (TPHA0G00520)
Membrane trafficking [BR:tpf04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    TPHA_0G00520 (TPHA0G00520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 TraF OST3_OST6 ATR13
Motif
Other DBs
NCBI-GeneID: 11533591
NCBI-ProteinID: XP_003686322
UniProt: G8BVG0
Position
7:101151..102176
Genome map
AA seq 341 aa AA seqDB search
MLVGTILRVVFICLQLRSSAASNENNFYDDNPYIMELTGKNFDKVIDNTNYTTMVEFYAP
WCGYCQKFKPVMEQVSKKLNGLMNVAAVNCDLSINKRLCSEQGIEGFPTVLFYSPMRINI
SVTYEDRTLFKRPAKQLYSGERKVAPIMNYAYTKIVNYAKKVTATKTIEKILGQKASVDG
KTQSRDLKMMLFSEKDKVFPLLKAIAIDWLGIMDVYLVAKTRLTAFMAEHSALKESHPNI
SLYLEELLAHQIEHKTKKDRRLVVFDTANDIYYEYDGDSFNKPEIAQFVTEKFGKVPLEG
PTSKKHKMIESILTGKNHNAKSRGTRKSREKSKNKRVHDEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttagtcggtactatattgagagttgtatttatttgcttacaactgcgctcttcagct
gcttcgaatgagaataatttttatgatgacaatccatacatcatggaactcacagggaag
aattttgataaagttatagataataccaattatacaacaatggtggagttttatgcccct
tggtgtggctattgtcagaagttcaaacctgttatggagcaagtcagtaagaaattgaat
ggattgatgaacgttgcagctgtaaattgtgatttgagcatcaataagagattatgctcc
gaacaaggtattgaagggttccccaccgtgctattttatagccctatgcggatcaacatt
tctgtcacttatgaggatagaactcttttcaagaggccagccaaacagttatatagtggt
gagaggaaagtggcacctataatgaattatgcatatacaaagatagtgaattatgcgaag
aaggttaccgctacaaagacaatagaaaagattttaggacagaaagcctctgtcgatggc
aaaacacaaagtagagatctgaaaatgatgttgttctctgagaaagacaaggttttccca
ttgctgaaggccattgcaatcgactggctgggaatcatggacgtatacctagtagctaaa
accagattgacagcttttatggccgagcattctgcattaaaggaatctcatccaaatatt
tccttgtacttagaagaactactcgctcaccaaattgaacataagaccaagaaggacaga
agacttgtggtctttgatacggcaaatgatatatactacgagtatgatggcgactctttc
aacaagcccgagattgctcaattcgttacagagaagtttggcaaagttccactcgaaggg
ccaacaagtaagaagcacaaaatgatagagagcattcttacaggcaagaatcacaatgca
aagagcagaggtacacgcaaaagcagagaaaagagtaagaataagagagttcatgacgag
ttgtag

DBGET integrated database retrieval system