KEGG   Tetrapisispora phaffii: TPHA_0G00560Help
Entry
TPHA_0G00560      CDS       T02235                                 

Gene name
TPHA0G00560
Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TPHA_0G00560 (TPHA0G00560)
Peptidases [BR:tpf01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TPHA_0G00560 (TPHA0G00560)
Transcription machinery [BR:tpf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TPHA_0G00560 (TPHA0G00560)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(105403..106794)
Genome map
AA seq 463 aa AA seqDB search
MSSCQHINHVLSNPNSRDGVLKACNATKYILMHSDAKDKYLNIKKCSDCHNIDNGSTFMC
LQCGYCGCWNSVHFIAHHKKVGHIFGINSSNGLLYCFICDDYVGDSEEINFSIVGKNWNY
IAENTSFPSYDRKDGLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDPV
SCLSCALDSVVFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYSQQDAHEFWQFLM
NRIHSEYKLNNNTIEVPKDTHQLCNCIYHKVFQGFLESTIECANCRKESKTTTEAYMDLS
LDLKDKKTLYECLNSFHMKEELKDFTFHCSNCGGPQGALKQLTISKLPPVLLLQLKRFEH
KLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPDDSDIIYELIGVICHTGTVNEGHY
ICSCKLANNQWVKFNDSMITIVDNETVLKEQAYLLIYSTKQVT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgtgtcaacatattaatcatgttttatctaatcctaactctagagatggtgtt
ttgaaagcatgcaatgctacgaaatatatcctaatgcattctgacgctaaagataagtat
ttgaatattaagaaatgctcagattgtcacaatattgacaacggttctacatttatgtgt
ttgcaatgtggatactgtggttgttggaattctgtgcactttatagcacatcacaagaaa
gttggacatatatttggtataaactcgagtaatggtctgttgtattgttttatctgtgat
gattatgtaggtgattctgaagagatcaatttttctattgtaggtaaaaattggaattat
atcgctgaaaatacatcctttcctagttatgatcgtaaggatggattatctgggctagtt
aatatgggttcaacttgttacatgagttgcataatacaatgcctggttcgtaatccgtat
tttttgaaacattctttcaatcaaactcattataaagaatgtaaaatacgtgatcctgta
tcgtgtctatcctgtgctttggattcagtagtgtttgaactatatggtaagacgcaaaag
aaagctgttgatgataaaaatggcggtttgattgatatattgaattgtacgtggaagatt
aatgaagatttagtcggttattcacaacaagacgcccatgaattttggcaatttctgatg
aatagaatacattccgaatacaaattgaacaataacacaattgaagtaccaaaggatact
catcagctatgtaattgtatttaccacaaagtgttccaaggtttcttggagagtactata
gaatgtgccaattgtaggaaagaatccaaaactactacagaggcctatatggatctatca
ttagatcttaaggataagaaaactttatatgagtgtcttaatagttttcatatgaaagaa
gaattgaaagatttcactttccattgtagtaattgtgggggaccccagggtgcacttaaa
caattgactatttcaaaattacctcctgttctattgttacaattaaaaagatttgagcat
aaactaaatggacagagtagtaaactaaatgattcgatagagtatcctccatatttgaga
atgaatgattattgccaaacttcctcgaatgaaaccatagacagtccagacgatagcgat
ataatatatgaactaatcggcgtcatatgtcatactggcacagtgaatgaaggtcattat
atatgtagttgtaagttagctaataaccaatgggtgaaatttaacgattccatgataact
attgttgataatgaaacagtattaaaagagcaggcttatttattaatatattcaacaaaa
caggtcacctag

DBGET integrated database retrieval system