KEGG   Tetrapisispora phaffii: TPHA_0G02530Help
Entry
TPHA_0G02530      CDS       T02235                                 

Gene name
TPHA0G02530
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPHA_0G02530 (TPHA0G02530)
Enzymes [BR:tpf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     TPHA_0G02530 (TPHA0G02530)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(521549..522421)
Genome map
AA seq 290 aa AA seqDB search
MASIKETSSIVTLTHPDNKETSVTILKYGATVYSWKREGVEQLWLSSAAKLDGSKPVRGG
IPLVFPAFGKNTTDKYLKDLPQHGFARNSNWTFKGIVRSYPPTVQFELNEGNANRELIKA
WPYKFTILYNIELGYDHLKTSVDIRNESDVPFDFNWLFHTYYNIQDSIENVYVHGLENQA
THDNITGKAAVEKNAEVIIDREVDRRYLNVDVKENITILNKKTNQLVHGLIRENLSDAVV
WNPWIKKSAGMGDFEPKDGYKNMLCVEPGHIHDLVTLRAKQKWSASQYMY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctagtattaaagaaacttcaagtatcgtcacattaactcatcctgacaacaaggaa
acgtccgtaacaattttgaaatatggtgccaccgtgtactcctggaaaagggaaggtgtt
gaacaattatggttatcatctgctgctaaactggatggttcaaagcctgttagaggtggt
atcccattggtgttccctgcttttggaaaaaatacaactgataaatacttaaaggattta
ccacaacatggttttgcaagaaattcaaactggactttcaagggtatagttagatcctat
ccaccaactgtccagttcgaattgaatgaaggaaacgcaaatcgagaattaattaaagct
tggccatataagttcaccattctttacaatatcgagttaggttacgatcatttgaaaaca
agtgtcgatattaggaatgaatcggatgttccattcgatttcaattggttattccacact
tattacaacatccaggactctattgagaatgtctatgtacatggtttagaaaaccaagcc
actcacgataacatcacaggtaaagctgccgtcgaaaaaaatgctgaagttattattgac
agagaggttgatagaagatatttaaatgttgatgtcaaagaaaacattactattttgaat
aagaaaactaaccagttagtccacggtttaatcagggaaaacctgtcagatgccgttgtt
tggaatccatggatcaagaaatctgccggtatgggtgatttcgaaccaaaagatggatac
aaaaacatgctctgtgtcgaacctggtcatatccacgatttagtcaccttaagagcaaaa
caaaaatggtctgcttctcaatatatgtattga

DBGET integrated database retrieval system