KEGG   Tetrapisispora phaffii: TPHA_0G02720Help
Entry
TPHA_0G02720      CDS       T02235                                 

Gene name
TPHA0G02720
Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TPHA_0G02720 (TPHA0G02720)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:578055..579131
Genome map
AA seq 358 aa AA seqDB search
MNQAEHLYGILHERNINEVQFGCDKRFSTWYGSNVYFDADNKMIKATNSKQANFKKYMYS
KKRAKGNDGKQIDIGQDDANVKPESKINDNDNENIEINDKENTSNNNDGNQNDPYWLDVI
YICEYCFKYCDNAESLIDHTKVCTFKEKVPGRLKYLGPKYQIRRVKGQKHTLFCQCLCLF
TKLFLDDKSMYFRIANYEFYIIYENGSTKPMGFFSKDIVSYNKNNLACILVFPPYQKRKL
GTILIELSYKISKFEGLKSSPEVPLSPFGLITYMNFWSNRICWELLEGELADLGSVTIED
ISTVTGFKPYDIVQTLQYLDCIDAAGNIQLSRMIEKVSSKHGKVSNSIIQDEHLLLGD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagctgaacatttgtatggtattttacatgaacgtaatatcaatgaggtgcag
tttggttgtgataagagattctctacgtggtatggtagtaatgtttattttgatgctgat
aataaaatgataaaggctacaaatagtaaacaggctaacttcaaaaaatatatgtatagt
aagaagagggcaaaggggaacgacggcaaacaaatagacattggacaggatgacgccaac
gttaaacctgaaagtaaaattaatgataatgataatgaaaatattgaaattaatgataaa
gagaacacgagtaacaataatgacggcaatcaaaatgatccatattggttagatgtgata
tatatttgcgaatattgtttcaaatattgcgataacgctgaatcgttgatagatcacaca
aaagtttgcacttttaaagagaaagtccctggaagattgaaatacttggggccaaaatat
caaataagaagagtgaaaggtcaaaaacatactttgttttgtcaatgtttatgtttattc
acgaaactatttcttgatgataagtccatgtactttagaattgcgaattatgaattctat
atcatttatgagaacggatctacaaagcccatgggtttcttttcaaaagatatagtttca
tataacaaaaacaatttagcgtgtatcctagtgtttccaccatatcagaaaagaaaatta
ggtactatattgattgaactatcatacaaaatatcaaaatttgagggcctgaaatcaagt
cctgaggtaccattatccccattcggtctaattacttacatgaatttctggtccaataga
atatgttgggagctactagaaggggaattagcagatctagggtctgttaccatagaagat
atatcaactgtgaccggattcaaaccgtatgatattgtacaaacactgcaatacctagat
tgcatcgatgcagcgggaaacatacaattatccaggatgatcgaaaaagtcagttctaag
catggtaaagtttccaattctataatacaagatgaacacttgctgctaggtgactaa

DBGET integrated database retrieval system