KEGG   Tetrapisispora phaffii: TPHA_0G03260Help
Entry
TPHA_0G03260      CDS       T02235                                 

Gene name
TPHA0G03260
Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
tpf  Tetrapisispora phaffii
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:698046..699389
Genome map
AA seq 447 aa AA seqDB search
MSETDIDDKILFDSDQKTTYSTSVNANPMQSLDNKAKIRTRSRRGSSLGRIDLGDTVRSL
GTMPSSKQEKKASKNRLKVLSMESKGDRDLLKKIWISYREMAYRNTWLNPLILLLIVYFM
YFTSGNRTETNPLHQFMYISYQIGDTDQYGKGIKDLSFVFFHMIFFTFIREFLMDVVIKP
VTIYVLKVTSPHRIKRIMEQVYTTCYTGVSGPFGIYIMYHSDLWLFETKTMYVTYPDLYN
SYLYKLFYLGQASFWAQQACVLVLQLEKPRKDHKELIFHHIVTLLLIWSSYVFHFTKMGL
AVYITMDVTDCLLALSKTLNYLESPLASPLFAFFFATWLYLRHYINLKILWSVLTQFRTE
GPYILNFATQQYKCWISLPIVFSLIFALQLLNVYWVILIIRVLYRIIFLGIEKDERSDSE
SDSEEDSEVSSESGDSEGESPTKAKKA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacagatattgatgataaaatactatttgatagtgaccaaaaaactacatac
agtacatcggtgaacgcaaacccgatgcaatctttagataataaagcaaaaattagaacc
agatctagaagaggttcttctttaggcagaattgaccttggcgatactgtacgaagcctt
ggcaccatgccaagctcgaagcaagagaagaaagcctcaaaaaatagactgaaagtacta
tcaatggagtctaaaggtgacagagatttgttgaaaaaaatttggatctcttacagagaa
atggcttatcgtaacacatggttgaacccattgatattgcttcttattgtttatttcatg
tattttacgtcgggaaacagaacggaaacaaatccattacatcaattcatgtatatatcc
tatcaaattggggataccgatcaatatggtaagggcataaaagatttatcatttgtattt
ttccatatgatttttttcacgtttataagagaatttctaatggacgtagtcataaagcca
gttactatttatgtcttaaaagtaacttctccccataggattaagagaatcatggaacag
gtatacacaacatgttacacaggtgtgtccggtccattcggtatttacatcatgtaccat
tcggatttatggttattcgaaacgaaaaccatgtatgtcacatatcctgatttatacaac
tcctatctttataagttattttacttaggtcaagcgtcattttgggctcaacaagcttgt
gttttggtcttacaattagaaaaaccaagaaaagatcataaagaactaattttccatcat
attgtcactttactattgatttggtcttcatatgttttccatttcacaaagatgggtcta
gcagtctacataactatggatgtcactgattgcttattagctttatccaaaacattgaac
tatttagaatccccattggcttctccactgtttgctttcttcttcgccacttggttgtat
ttgcgtcattacattaacttaaagattctttggtcagtactaacgcaattccgtacagaa
ggtccatatatattaaattttgctactcaacaatacaaatgttggatttctttaccaatt
gtcttttcattaatttttgcactacagttattgaatgtttattgggttattttaatcatt
agagttctttatagaatcatctttttaggaatcgaaaaagatgaaagaagtgacagtgaa
tcagattcagaagaagacagtgaggtttcatctgaatctggtgattcagaaggtgaatct
ccaaccaaagcaaaaaaagcatag

DBGET integrated database retrieval system