KEGG   Tetrapisispora phaffii: TPHA_0H01180Help
Entry
TPHA_0H01180      CDS       T02235                                 

Gene name
TPHA0H01180
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:261522..263354
Genome map
AA seq 610 aa AA seqDB search
MVGRRRGRRNTAKGSPLKKAKIEKEPEVKENIQDEKEDTLKTIINEKEKSDEKVIADKDE
DAHSKSDQVTEEVGKEDRVSENKQTNNNKDEHVIPQMEEKSNYIETKVDGNEKDGVADEE
PKGPKGPEELEELEEPEEPEEPEEPEKPEKPEKTIEDKTGETTGSKTRDESNKNSIDLKE
ENREINESAGLEPANDIDDATVDHKSVEVSEIDNGLVKIESIENVENVETMPTINLESET
EKGVTTFMFDGVKYTFKERVSVLEEKENKIEFRVVNCDNSKESMMILTGLKNIFQKQLPK
MPKEYIARLVYDRSHVSIAVVRHPLTVVGGITFRPFEAKEFAEIVFCAISSTEQVRGYGA
HLMNHLKDYVRNSSPIKHFLTYADNYAIGYFKKQGFTKEITLDKKIWMGYIKDYEGGTLM
QCSMLPRIRYLDAPKILLLQEAALMRKIRTISQSHIIRAGLDHFKDLKNITPIDPMTIPG
LKEAGWTTEMDELAQRPKRGPHYAAMQNILTELQNHAAAWPFLQPVNKEEVPDYYEFIKE
PMDLSTMEVKLENNRYEKMENYIYDARLIFENCRKYNGDNTSYFKYANRLEKFFNSKVKD
YPEYSQLVDN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagacgtaggggaagaagaaatactgctaaaggttcaccattaaaaaaagcg
aaaattgaaaaagaacctgaagtaaaggaaaatattcaagatgaaaaagaagatactttg
aaaacgattataaatgaaaaagaaaagtcagatgaaaaggtaattgcagataaagatgaa
gatgcacatagcaagagcgatcaggttacggaagaagttggtaaagaagatcgtgtatca
gaaaataagcaaacgaataataacaaagatgagcatgtgattccgcagatggaggaaaag
agtaactatattgaaaccaaggtagatggaaacgagaaagatggggttgcagatgaggaa
ccaaaaggaccaaaaggaccagaggagttagaggagttagaagagccagaagagccagaa
gagccagaagagccagaaaaaccagaaaaaccagaaaagaccattgaggataagactgga
gagactacaggaagtaaaaccagagatgaaagcaataaaaactcaatagatcttaaggaa
gaaaatagagaaataaacgagagtgccggtctagaacccgctaacgatattgatgatgct
actgtggatcataaatcagtagaagtgagtgaaattgataatggtcttgtgaaaattgaa
tcaattgaaaatgtagaaaatgttgaaacaatgcctacaattaatttagagagtgaaaca
gaaaaaggagttaccacatttatgtttgatggagtgaaatatacgtttaaagagagagtt
agtgttttagaggaaaaagaaaataaaattgaattcagagtagtcaactgtgataattct
aaagaaagtatgatgattttaaccggtttaaaaaatatctttcaaaaacaattgccaaaa
atgcctaaagaatatattgcaaggttagtttatgatagaagccatgtttcaattgctgtt
gtcagacatccactaaccgtcgtaggtggaatcacattccgtccatttgaagcaaaagaa
tttgctgaaattgttttttgtgccattagttcaactgagcaagttcgtggttatggtgca
catttaatgaaccatttaaaagattatgtacgaaattcatctcctataaaacacttctta
acatatgccgataactatgctattggttactttaaaaaacaaggtttcaccaaagaaatt
actttagataaaaaaatatggatgggttacattaaggattatgaaggtggtactctaatg
caatgttccatgcttccacgtatacggtatcttgatgctccaaagatattattattgcaa
gaggctgctttaatgagaaagattaggacaatttcccaatcacatatcatcagagctggc
ttggatcattttaaagacttaaaaaatattaccccaattgatccaatgacaattccaggg
ttaaaagaggctggatggacgactgaaatggacgaattagctcaaagaccaaaacgtggt
ccacattatgctgctatgcaaaatatattgacagaattacaaaatcatgctgctgcatgg
ccatttctacaaccagttaataaagaagaagttcctgattactatgaatttataaaagag
cctatggacttgagcaccatggaggttaaacttgaaaataatagatatgaaaagatggaa
aattatatatatgatgctagacttatttttgagaattgtcgtaagtataatggtgataat
acttcgtactttaagtatgcgaataggttagagaagtttttcaactcaaaggttaaagat
tatcctgaatattcacaactggttgacaactaa

DBGET integrated database retrieval system