KEGG   Tetrapisispora phaffii: TPHA_0H01430Help
Entry
TPHA_0H01430      CDS       T02235                                 

Gene name
TPHA0H01430
Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tpf  Tetrapisispora phaffii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tpf03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:321562..322344
Genome map
AA seq 260 aa AA seqDB search
MSWDDDFVAGNDDDTVLMESWDAEETIEEKKQKEAELKRQEQLLKTQETANKKNKNKSST
DQVLMEIDTLDDATRKELIKKAELESDLNNAAELFGSLGVAEEHPRALAARKEKELEAMM
KPASLTRDTPLESHPIFNAESKKEFQDLRKAISAAVTPLNEVSSLNYSSSLAIDLIRDVA
NPMSVESIRQTIATLNVLMKDKERQERQARLARVKGGTATGGAGKKKIKGKTNLGGAFKK
DQDFSLETEDFGDFGDDDFM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggacgacgattttgttgctggtaatgatgacgatactgtcttaatggaatca
tgggatgctgaagagaccatcgaagagaagaaacaaaaggaagctgagttgaagagacaa
gagcaattgctgaagacacaagagactgctaacaagaagaacaagaacaagtcttctact
gaccaagtgttgatggaaattgacaccttagatgacgcaactcgtaaagaattgattaaa
aaagctgagttggaatccgatctaaacaatgctgctgaattgtttggttctttgggtgtt
gctgaagaacatccaagagctttggctgctagaaaagaaaaagagttggaagccatgatg
aaacctgcttctttaactagagacacaccattagaaagccatccaatctttaatgctgaa
tcaaagaaagaattccaagatttgagaaaagctatatctgctgctgtcactccattgaac
gaagtttcctccttgaactactcatcatctttagccattgatttgatcagagatgttgca
aatcctatgtctgttgaatctattagacaaactattgctactctaaacgttttaatgaag
gataaagaaagacaagaaagacaagccagattagctcgtgtcaagggcggtaccgcaact
ggtggtgccggtaagaagaagattaagggaaaaaccaatttaggtggtgcattcaagaaa
gatcaagatttcagtttagaaactgaagattttggtgatttcggtgacgatgatttcatg
taa

DBGET integrated database retrieval system