KEGG   Tetrapisispora phaffii: TPHA_0H02500Help
Entry
TPHA_0H02500      CDS       T02235                                 

Gene name
TPHA0H02500
Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tpf  Tetrapisispora phaffii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tpf00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:589935..590465
Genome map
AA seq 176 aa AA seqDB search
MVQAYIHDDNNDIDFREAHNSGKSVSIEDLEKIGVFYKYCATVEDVDVIAKERNYKNRDV
VNISKESFGNENNMMEKLNMFYSEHLHEDEEIRYCLDGSGYFDLRAQNDTDWIRCRVNKG
DLLVVPAGIYHRFTLTTENYIKALRLFKDEPKWNAIKRPDGDSYQVREEYLSQTKA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagcttatattcacgacgataacaacgacatagacttcagagaagcccataat
agtggaaagtcggttagcattgaagatttagaaaagattggtgtcttttacaagtattgt
gctaccgtggaagacgtagatgttatcgcaaaagaaagaaactataagaatagagatgtc
gtgaatatttcaaaagagtcttttggtaatgagaataatatgatggaaaaactcaacatg
ttttactcagagcatctgcacgaggatgaagaaataagatactgtttggatggcagcggt
tacttcgacttgagagctcaaaatgatacggactggatccgttgtagagtgaacaaaggt
gatctgttagtggtcccagctggaatctaccatagatttactttgactacggagaactat
atcaaggcccttaggttgttcaaagatgaaccaaaatggaatgcaataaaaaggcctgac
ggggactcgtatcaagtacgtgaagaatatctatcgcagacaaaagcttaa

DBGET integrated database retrieval system