KEGG   Tetrapisispora phaffii: TPHA_0I01570Help
Entry
TPHA_0I01570      CDS       T02235                                 

Gene name
TPHA0I01570
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPHA_0I01570 (TPHA0I01570)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TPHA_0I01570 (TPHA0I01570)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TPHA_0I01570 (TPHA0I01570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:357184..358161
Genome map
AA seq 325 aa AA seqDB search
MTFDMLEKQETPHYNFIKGHALTVIKAPFSDGQSKKGVEKGPDYLLKQGLVHDLENLGWT
TEIVNPLAEVTGSVQNVTTYKNIHNIDSVACSTELIYKTVRDTTKDGRFALTLGGDHSIA
IGTILGALKTYPDLGLLWIDAHADINTLDTTESGNIHGCPVAFAMGLNEVVPAPFSWLNS
LRKLKKNRIAYIGLRDIDEGEKQVLKENNITSVFTMYHIDRYGMNNVIEMALKALNKDGD
SPILCSYDVDSVDPLYVPATGTPVRGGLTLREGLFLAERLAETGNLVGLDIVECNPDLAT
NDIHVVDTISAGCAVARCALGETLF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgatatgttagaaaaacaagaaaccccacactataattttattaagggccat
gctttgacagttatcaaggctccattctcagatggtcagtcaaagaaaggtgttgaaaaa
ggcccagactatcttttgaagcaaggtttagtgcacgatctagagaatttaggttggact
accgaaattgtcaacccattagctgaggtaactggaagtgttcagaatgttacaacttat
aagaatatccacaacatagattctgttgcttgttctacggaacttatttacaaaactgtc
cgggatactacaaaggatggtcggtttgccttgactttgggtggtgatcattccattgct
attggtactatattaggtgcattgaaaacctatccagatctgggtttactttggatcgat
gcacatgccgatattaatactttggatacaactgaatcgggcaatattcatggatgccct
gttgcttttgcaatgggtttgaatgaagttgttcctgctcctttctcttggttaaattca
ttaagaaaattaaagaaaaacagaattgcatatattggcttaagagatattgatgaaggt
gaaaagcaggtcttaaaagaaaataatattacgtcagtattcacaatgtatcacatcgat
agatacggcatgaataacgtcatcgaaatggcattgaaggctcttaataaagatggagat
tctcccattctatgttcttatgatgtcgattctgtggatccattgtatgtacctgctacc
ggtacaccagtaagaggtgggctcaccttgagagaaggtttgttcttagccgaacggtta
gcagaaactggtaacttagtaggtttagatatagtcgaatgtaatccagatttggccaca
aatgatatccacgttgtagacactatttcggcaggctgtgctgttgcaaggtgtgcatta
ggtgaaacattattttaa

DBGET integrated database retrieval system